Traitement en cours

Veuillez attendre...

Paramétrages

Paramétrages

Aller à Demande

1. WO2020115048 - ANALOGUES PEPTIDIQUES DE GIP MODIFIÉS

Note: Texte fondé sur des processus automatiques de reconnaissance optique de caractères. Seule la version PDF a une valeur juridique

[ EN ]

Claims

1. A glucose-dependent insulinotropic peptide (GIP) analogue

consisting of amino acid sequence SEQ ID NO: XX:

3 - 4 5 6 7 8 9 10 11 12 13 14 15 16 17

Xi — X2 — T - F — I — S — D — Y — S — I — A — M — D — K — I

18 19 20 21 22 23 24 25 26 27 28 29 30

H - Q - Q - D - F - V - N - W - L - L - A - Q - K - Z,

wherein Xi and x2 are individually any amino acid or omitted;

or a functional variant thereof, wherein said variant has 1 to 8 individual amino acid substitutions at any amino acid of SEQ ID NO: XX,

wherein said peptide is modified by attaching at least one fatty acid molecule at one or more amino acid residues at positions 3 to 29 of SEQ ID NO XX, or said functional variant thereof,

wherein Z is a peptide comprising one or more amino acid residues of GIP(31- 42) (GKKNDWKHNITQ; SEQ ID NO: Z) or one or more amino acid residues of Exendin-4 (HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS; SEQ ID NO: E).

2. A glucose-dependent insulinotropic peptide (GIP) analogue

consisting of amino acid sequence SEQ ID NO: XX:

3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 Xi — X2 — T - F — I — S — D — Y — S — I — A — M — D — K — I

18 19 20 21 22 23 24 25 26 27 28 29 30

H - Q - Q - D - F - V - N - W - L - L - A - Q - K - Z,

wherein Xi and x2 are individually any amino acid or omitted;

or a functional variant thereof, wherein said variant has 1 to 4 individual amino acid substitutions at any amino acid of SEQ ID NO: XX,

wherein said peptide is modified by attaching at least one fatty acid molecule at one or more amino acid residues at positions 3 to 29 of SEQ ID NO XX, or said functional variant thereof,

wherein Z is a peptide comprising one or more amino acid residues of GIP(31- 42) (GKKNDWKHNITQ; SEQ ID NO: Z) or one or more amino acid residues of Exendin-4 (HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS; SEQ ID NO: E).

3. The GIP peptide analogue according to any one of the preceding claims,

wherein said GIP peptide analogue is an antagonist of GIPR.

4. The GIP peptide analogue according to any one of the preceding claims,

wherein said GIP peptide analogue inhibits GIPR activity of at least 80%, such as of at least 85%, such as of at least 90%, such as of at least 95%, such as of about 100%.

5. The GIP peptide analogue according to any one of the preceding claims,

wherein said GIP peptide analogue inhibits GIPR activity of at least 80%, such as of at least 85%, such as of at least 90%, such as of at least 95%, such as of about 100%, wherein inhibition of GIPR activity is determined as a decrease in intracellular cAMP.

6. The GIP peptide analogue according to any one of the preceding claims,

wherein said GIP peptide analogue has a GIPR antagonistic potency corresponding to an IC50 value of 50 nM or less than 50 nM.

7. The GIP peptide analogue according to any one of the preceding claims,

wherein:

the amino acid at position 5 is T or omitted;

the amino acid at position 9 is selected from D, E and T;

the amino acid at position 1 1 is selected from S, K and A;

the amino acid at position 12 is selected from I, K and 2-Aminoisobutyric acid

(Aib);

the amino acid at position 13 is selected from A and Aib;

the amino acid at position 14 is selected from M, K, E, S, L and Nle;

the amino acid at position 15 is selected from D and E;

the amino acid at position 16 is selected from K and R;

the amino acid at position 17 is selected from I and K;

the amino acid at position 18 is selected from H and K;

the amino acid at position 20 is selected from Q and K;

the amino acid at position 21 is selected from D and E;

the amino acid at position 24 is selected from N, K, Q and E;

the amino acid at position 28 is selected from A and E;

the amino acid at position 29 is selected from Q and G; and/or

the amino acid at position 30 is selected from K, R, G and A.

8. The GIP peptide analogue according to any one of the preceding claims,

wherein said functional variant has 1 individual amino acid substitution, such as 2 individual amino acid substitutions, for example 3 individual amino acid substitutions, such as 4 individual amino acid substitutions at any amino acid residue of SEQ ID NO: XX.

9. The GIP peptide analogue according to any one of the preceding claims,

wherein said functional variant has 1 to 2 individual amino acid substitutions, such as 2 to 3 individual amino acid substitutions, such as 3 to 4 individual amino acid substitutions, such as 4 to 5 individual amino acid substitutions, such as 5 to 6 individual amino acid substitutions, such as 6 to 7 individual amino acid substitutions, such as 7 to 8 individual amino acid substitutions at any amino acid residue of SEQ ID NO: XX.

10. The GIP peptide analogue according to any one of the preceding claims,

wherein said functional variant has 1 individual amino acid substitution, such as 2 individual amino acid substitutions, for example 3 individual amino acid substitutions, such as 4 individual amino acid substitutions at any amino acid residue of SEQ ID NO: XX, wherein said substitutions are conservative amino acid substitutions.

1 1. The GIP peptide analogue according to any one of the preceding claims,

wherein Xi and X2 are omitted.

12. The GIP peptide analogue according to any one of the preceding claims,

wherein Xi, X2 and the amino acid residue at position 5 are omitted.

13. The GIP peptide analogue according to any one of the preceding claims,

wherein said variant has 1 to 7 individual amino acid substitutions, such as 1 individual amino acid substitutions, such as 2 individual amino acid

substitutions, such as 3 individual amino acid substitutions, such as 4 individual amino acid substitutions, such as 5 individual amino acid substitutions, such as 6 individual amino acid substitutions, such as 7 individual amino acid

substitutions at any one of amino acid residues 3 to 30 of SEQ ID NO: XX.

14. The GIP peptide analogue according to any one of the preceding claims,

wherein said functional variant has 1 to 2 individual amino acid substitutions, such as 2 to 3 individual amino acid substitutions, such as 3 to 4 individual amino acid substitutions, such as 4 to 5 individual amino acid substitutions, such as 5 to 6 individual amino acid substitutions, such as 6 to 7 individual amino acid substitutions, such as 7 to 8 individual amino acid substitutions at any one of amino acid residues 3 to 30 of SEQ ID NO: XX.

15. The GIP peptide analogue according to any one of the preceding claims,

wherein said functional variant has 1 to 2 individual amino acid substitutions, such as 2 to 3 individual amino acid substitutions, such as 3 to 4 individual amino acid substitutions, such as 4 to 5 individual amino acid substitutions, such as 5 to 6 individual amino acid substitutions, such as 6 to 7 individual amino acid substitutions, such as 7 to 8 individual amino acid substitutions at any one of amino acid residues 3, 4, 7, 8, 9, 11 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 24, 28, 29 and 30 of SEQ ID NO: XX.

16. The GIP peptide analogue according to any one of the preceding claims,

wherein said functional variant has 1 to 2 individual amino acid substitutions at any one of amino acid residues 4 to 10 of SEQ ID NO: GIP(3-30)XI-X2, SEQ I D

NO: GIP(3-30)X2, SEQ ID NO: GIP(3-30)Xi, SEQ ID NO: GIP(3-30), SEQ ID NO: GIP(4-30)X2, SEQ ID NO: GIP(4-30), SEQ ID NO: GIP(5-30), SEQ ID NO: GIP(6-30).

17. The GIP peptide analogue according to any one of the preceding claims,

wherein said functional variant has 1 to 2, such as 1 to 3, such as 2 to 3 individual amino acid substitutions at any one of amino acid residues 19 to 27 of SEQ ID NO: XX.

18. The GIP peptide analogue according to any one of the preceding claims, wherein at least one amino acid residue of the GIP peptide analogue of SEQ ID NO: XX is substituted with E, such as wherein at least one amino acid residue at any one of positions 9, 15, 21 and 24 of SEQ ID NO: XX is substituted with E.

19. The GIP peptide analogue according to any one of the preceding claims,

wherein Xi is an amino acid residue selected from the group consisting of E, S, G, V, 2-Aminoisobutyric acid (Aib), P, D, y-glutamic acid (yGlu), D-y-glutamic acid (D-yGlu), b-Glutamic acid (3Glu), pyroE (pyroglutamic acid), glutaric acid.

20. The GIP peptide analogue according to any one of the preceding claims,

wherein Xi is E.

21. The GIP peptide analogue according to any one of the preceding claims,

wherein x2 is an amino acid residue selected from the group consisting of G,E, T, K and Orn.

22. The GIP peptide analogue according to any one of the preceding claims,

wherein the D at position 9 of SEQ ID NO:XX, or a functional variant thereof, is substituted with any amino acid, such as a conservative amino acid substitution, such as substituted with an amino acid residue selected from the group consisting of E and T.

23. The GIP peptide analogue according to any one of the preceding claims,

wherein the S at position 1 1 of SEQ ID NO:XX, or a functional variant thereof, is substituted with any amino acid, such as a conservative amino acid substitution, such as substituted with an amino acid residue selected from the group consisting of A, K and Orn.

24. The GIP peptide analogue according to any one of the preceding claims,

wherein the I at position 12 of SEQ ID NO:XX, or a functional variant thereof, is substituted with any amino acid, such as a conservative amino acid substitution, such as substituted with an amino acid residue selected from the group consisting of K, Orn and 2-Aminoisobutyric acid (Aib).

25. The GIP peptide analogue according to any one of the preceding claims, wherein the A at position 13 of SEQ ID NO:XX, or a functional variant thereof, is substituted with any amino acid, such as a conservative amino acid substitution, such as substituted with 2-Aminoisobutyric acid (Aib).

26. The GIP peptide analogue according to any one of the preceding claims,

wherein the M at position 14 of SEQ ID NO:XX, or a functional variant thereof, is substituted with any amino acid, such as a conservative amino acid substitution, such as substituted with an amino acid residue selected from the group consisting of L, Norleucine (Nle), E, S, K and Orn.

27. The GIP peptide analogue according to any one of the preceding claims,

wherein the M at position 14 of SEQ ID NO:XX, or a functional variant thereof, is substituted with an amino acid residue selected from the group consisting of L, Norleucine (Nle) and K.

28. The GIP peptide analogue according to any one of the preceding claims,

wherein the D at position 15 of SEQ ID NO:XX, or a functional variant thereof, is substituted with any amino acid, such as a conservative amino acid substitution, such as substituted with E.

29. The GIP peptide analogue according to any one of the preceding claims,

wherein the K at position 16 of SEQ ID NO:XX, or a functional variant thereof, is substituted with any amino acid, such as a conservative amino acid substitution, such as substituted with R.

30. The GIP peptide analogue according to any one of the preceding claims,

wherein the I at position 17 of SEQ ID NO:XX, or a functional variant thereof, is substituted with any amino acid, such as a conservative amino acid substitution, such as substituted with an amino acid residue selected from the group consisting of K or Orn.

31. The GIP peptide analogue according to any one of the preceding claims,

wherein the H at position 18 of SEQ ID NO:XX, or a functional variant thereof, is substituted with any amino acid, such as a conservative amino acid substitution, such as substituted with an amino acid residue selected from the group consisting of K and Orn.

32. The GIP peptide analogue according to any one of the preceding claims,

wherein the Q at position 20 of SEQ ID NO:XX, or a functional variant thereof, is substituted with any amino acid, such as a conservative amino acid substitution, such as substituted with an amino acid residue selected from the group consisting of K and Orn.

33. The GIP peptide analogue according to any one of the preceding claims,

wherein the D at position 21 of SEQ ID NO:XX, or a functional variant thereof, is substituted with any amino acid, such as a conservative amino acid substitution, such as substituted with E.

34. The GIP peptide analogue according to any one of the preceding claims,

wherein the N at position 24 of SEQ ID NO:XX, or a functional variant thereof, is substituted with any amino acid, such as a conservative amino acid substitution, such as substituted with an amino acid residue selected from the group consisting of Q and E.

35. The GIP peptide analogue according to any one of the preceding claims,

wherein the N at position 24 of SEQ ID NO:XX, or a functional variant thereof, is substituted any amino acid, such as a conservative amino acid substitution, such as substituted with E.

36. The GIP peptide analogue according to any one of the preceding claims,

wherein the A at position 28 of SEQ ID NO:XX, or a functional variant thereof, is substituted with any amino acid, such as a conservative amino acid substitution, such as substituted with E.

37. The GIP peptide analogue according to any one of the preceding claims,

wherein the Q at position 29 of SEQ ID NO:XX, or a functional variant thereof, is substituted with any amino acid, such as a conservative amino acid substitution, such as substituted with G.

38. The GIP peptide analogue according to any one of the preceding claims, wherein the K at position 30 of SEQ ID NO: XX, or a functional variant thereof, is substituted with any amino acid, such as a conservative amino acid substitution, such as substituted with an amino acid residue selected from the group consisting of R, A and G.

39. The GIP peptide analogue according to any one of the preceding claims,

wherein said GIP peptide analogue comprises at least one substitution to K and one substitution to E or Aib at any one of amino acid residues 3 to 30 of SEQ ID

NO: XX.

40. The GIP peptide analogue according to claim 1, wherein said peptide consists of SEQ ID NO: (GIP3-30 X1-X2):


18 19 20 21 22 23 24 25 26 27 28 29 30

H - Q - Q - D - F - V - N - W - L - L - A - Q - K - Z.

41. The GIP peptide analogue according to claim 1, wherein said peptide consists of SEQ ID NO: (GIP3-30 X2):


18 19 20 21 22 23 24 25 26 27 28 29 30

H - Q - Q - D - F - V - N - W - L - L - A - Q - K - Z.

42. The GIP peptide analogue according to claim 1, wherein said peptide consists of SEQ ID NO: (GIP3-30 Xi):


18 19 20 21 22 23 24 25 26 27 28 29 30

H - Q - Q - D - F - V - N - W - L - L - A - Q - K - Z.

43. The GIP peptide analogue according to claim 1, wherein said peptide consists of SEQ ID NO: (GIP3-30):

18 19 20 21 22 23 24 25 26 27 28 29 30

H - Q - Q - D - F - V - N - W - L - L - A - Q - K - Z.

44. The GIP peptide analogue according to claim 1, wherein said peptide consists of SEQ ID NO: (GIP4-30 X2):


18 19 20 21 22 23 24 25 26 27 28 29 30

H - Q - Q - D - F - V - N - W - L - L - A - Q - K - Z.

45. The GIP peptide analogue according to claim 1, wherein said peptide consists of SEQ ID NO: (GIP4-30):


18 19 20 21 22 23 24 25 26 27 28 29 30

H - Q - Q - D - F - V - N - W - L - L - A - Q - K - Z.

46. The GIP peptide analogue according to claim 1, wherein said peptide consists of SEQ ID NO: (GIP5-30):


18 19 20 21 22 23 24 25 26 27 28 29 30

H - Q - Q - D - F - V - N - W - L - L - A - Q - K - Z.

47. The GIP peptide analogue according to claim 1, wherein said peptide consists of SEQ ID NO: (GIP6-30):


18 19 20 21 22 23 24 25 26 27 28 29 30

H - Q - Q - D - F - V - N - W - L - L - A - Q - K - Z.

48. The GIP peptide analogue according to any one of the preceding claims, wherein Z consists of one or more consecutive amino acid residues of GIP(31- 42) (SEQ ID NO: Z).

49. The GIP peptide analogue according to any one of the preceding claims, wherein Z consists of one or more consecutive amino acid residues of Exendin- 4 (SEQ ID NO: E).

50. The GIP peptide analogue according to any one of the preceding claims,

wherein Z consists of one or more amino consecutive acid residues of the C- terminus of Exendin-4(30-39) (PSSGAPPPS; SEQ ID NO: CE31-39).

51. The GIP peptide analogue according to any one of the preceding claims,

wherein Z consists of one or more amino consecutive acid residues of the C- terminus of Exendin-4(29-39) (GPSSGAPPPS; SEQ ID NO: CE30-39).

52. The GIP peptide analogue according to any one of the preceding claims,

wherein Z comprises at least one G or one P.

53. The GIP peptide analogue according to any one of the preceding claims,

wherein Z comprises at least two P.

54. The GIP peptide analogue according to any one of the preceding claims,

wherein Z is a peptide selected from the group consisting of

a glycine or a proline,

- GP, GPS, GPSS, GPSSG, GPSSGA, GPSSGAP, GPSSGAPP,

GPSSGAPPP and GPSSGAPPPS,

- PS, PSS, PSSG, PSSGA, PSSGAP, PSSGAPP, PSSGAPPP and

PSSGAPPPS,

- GK, GKK, GKKN, GKKND, GKKNDW, GRKNDW, GKRNDW,

GRRNDW, GKKNDWK, GKKNDWKH, GKKNDWKHN, GKKNDWKHNI, GKKNDWKHNIT and GKKNDWKHNITQ,

- GPSSGA, GPSSGAP, GPSSGAPP, GPSSGAPPP, GPSSGAPPPS, GKKNDW, GKKKDW, GKKNDK GRKNDW, GKRNDW, GRRNDW, GKKNDWK, GKKNDWKH, GKKNDWKHN, GKKNDWKHNI, GKKNDWKHNIT and GKKNDWKHNITQ, or a variant thereof comprising 1 or 2 individual amino acid substitutions at any one of the amino acid residues, or

- PSSG, PSSGA, PSSGAP, PSSGAPP, PSSGAPPP and PSSGAPPPS, or a variant thereof comprising 1 or 2 individual amino acid substitutions at any one of the amino acid residues.

55. The GIP peptide analogue according to any of the preceding claims, wherein a fatty acid molecule is not attached at the amino acid residue at position 3 of SEQ ID NO: XX or a variant thereof.

56. The GIP peptide analogue according to any of the preceding claims, wherein a fatty acid molecule is not attached at the N-terminal amino group of the amino acid residue at position 3 of SEQ ID NO: (GIP3-30 X1-X2), SEQ ID NO: (GIP3- 30 Xi) or SEQ ID NO: (GIP3-30 X2).

57. The GIP peptide analogue according to any of the preceding claims, wherein a fatty acid molecule is not attached at the N-terminal amino group of the amino acid residue at position 4 of SEQ ID NO: (GIP4-30 X2) or SEQ ID NO: (GIP4- 30).

58. The GIP peptide analogue according to any of the preceding claims, wherein a fatty acid molecule is not attached at the N-terminal amino group of the amino acid residue at position 5 of SEQ ID NO: (GIP5-30).

59. The GIP peptide analogue according to any of the preceding claims, wherein a fatty acid molecule is not attached to an amino acid residue of Z.

60. The GIP peptide analogue according to any of the preceding claims, wherein the GIP peptide analogue has a free N-terminus.

61 . The GIP peptide analogue according to any of the preceding claims, wherein one or more fatty acid molecule(s) is attached to the side chain of an amino acid residue at position 6, position 7, position 8, position 9, position 10, position 1 1 , position 12, position 13, position 14, position 15, position 16, position 17, position 18, position 19, position 20, position 21 , position 22, position 23, position 24, position 25, position 26, position 27, position 28 or position 29 of said GIP peptide analogue, such as of SEQ ID NO: XX, or a functional variant thereof.

62. The GIP peptide analogue according to any of the preceding claims, wherein said at least one fatty acid molecule is attached to one or more amino acid

residues in the mid-region of SEQ ID NO: XX, or a functional variant thereof; such as attached to one or more amino acid residues at any one of positions 1 1 to 21 of SEQ ID NO: XX, or a functional variant thereof.

63. The GIP peptide analogue according to any of the preceding claims, wherein said at least one fatty acid molecule is attached to one or more amino acid residues at any one of positions 1 1 , 12, 17 and 18 of SEQ ID NO: XX, or a functional variant thereof.

64. The GIP peptide analogue according to any of the preceding claims, wherein a fatty acid molecule is attached to the epsilon-amino group of a K or Orn residue of said GIP peptide analogue, such as of SEQ ID NO: XX, or a functional variant thereof comprising at least one K or Orn residue.

65. The GIP peptide analogue according to any of the preceding claims, wherein a fatty acid molecule is attached to the side chain amino group of the amino acid residue at position 18 of SEQ ID NO: XX, or a variant thereof, wherein H at position 18 has been substituted with K or Orn in SEQ ID NO: XX.

66. The GIP peptide analogue according to any of the preceding claims, wherein a fatty acid molecule is attached to the side chain amino group of the amino acid residue at position 11 of SEQ ID NO: XX, or a variant thereof, wherein S at position 11 has been substituted with K or Orn in SEQ ID NO: XX.

67. The GIP peptide analogue according to any of the preceding claims, wherein a fatty acid molecule is attached to the side chain amino group of the amino acid residue at position 12 of SEQ ID NO: XX, or a variant thereof, wherein I at position 12 has been substituted with K or Orn in SEQ ID NO: XX.

68. The GIP peptide analogue according to any of the preceding claims, wherein the K at position 30 of SEQ ID NO: XX, or a functional variant thereof, is substituted with any amino acid residue, and a fatty acid molecule is attached to an amino acid residue at a position other than position 30 of SEQ ID NO: XX, or a functional variant thereof.

69. The GIP peptide analogue of any one of the preceding claims, wherein said GIP peptide analogue has an amino acid sequence selected from the group consisting of:

EGTFISDYSIAMDKIHQQDFVNWLLAQK-Z; SEQ ID NO: ; GIP(3-30),

EGTFISDYSIAMDKIKQQDFVNWLLAQK - Z; SEQ ID NO: ; GIP(3-30) [H18K], SGTFISDYSIAMDKIKQQDFVNWLLAQK - Z; SEQ ID NO: ; GIP(3-30) [E3S ;H18K],

SGTFISDYSIAMDRIKQQDFVNWLLAQR - Z; SEQ ID NO: ; GIP(3-30)

[E3S;K16R;H18K;K30R],

EGTFISDYKIAMDKIHQQDFVNWLLAQK - Z; SEQ ID NO: ; GIP(3-30) [S11 K], EGTFISDYSKAMDKIHQQDFVNWLLAQK - Z; SEQ ID NO: ; GIP(3-30) [I12K], EGTFISDYSIAMDKIHQKDFVNWLLAQK - Z; SEQ ID NO: ; GIP(3-30) [Q20K], EGTFISDYSIAMDKIHQQDFVKWLLAQK - Z; SEQ ID NO: ; GIP(3-30) [N24K], EGTFISDYSIAMDKKHQQDFVNWLLAQK - Z; SEQ ID NO: ; GIP(3-30) [I17K], EGTFISDYSIAMDKIKQQDFVNWLLAQG - Z; SEQ ID NO: ; GIP(3-30)

[H18K;K30G],

EGTFISDYSIAMDKIKQQDFVNWLLAGG - Z; SEQ ID NO: ; GIP(3-30)

[H18K;Q29G;K30G],

EGTFISEYSIAMEKIKQQEFVQWLLAQK - Z; SEQ ID NO: ; GIP(3-30)

[D9E;D15E;H18K;D21 E;N24Q],

EGTFISEYSIAMEKIKQQDFVQWLLAQK - Z; SEQ ID NO: ; GIP(3-30)

[D9E;D15E;H18K;N24Q],

EGTFISEYSAibANIeEKIKQQDFVEWLLAQK - Z; SEQ ID NO: ; GIP(3-30) [D9E;l12Aib;M14Nle;D15E;H18K;N24E],

EGTFISEYSIAibMEKIKQQDFVEWLLAQK - Z; SEQ ID NO: ; GIP(3-30)

[D9E;A13Aib;D15E;H18K;N24E],

EGTFISDYSIAMDKIKQQDFVEWLLAQK - Z; SEQ ID NO: ; GIP(3-30)

[H18K;N24E],

EGTFISDYSIALDKIKQQDFVNWLLAQK - Z; SEQ ID NO: ; GIP(3-30)

[M14L;H18K],

EGTFISDYSIANIeDKIKQQDFVNWLLAQK - Z; SEQ ID NO: ; GIP(3-30)

[M14Nle;H18K],

EGTFISDYSIAEDKIKQQDFVNWLLAQK - Z; SEQ ID NO: ; GIP(3-30)

[M14E;H18K],

EGTFISDYSIAKDKIKQQDFVNWLLAQK - Z; SEQ ID NO: ; GIP(3-30)

[M14K;H 18K],

EGTFISDYSIASDKIKQQDFVNWLLAQK - Z; SEQ ID NO: ; GIP(3-30) [M14S;H 18K],

EGTFISDYSIAMDKIKQQDFVEWLLAQA - Z; SEQ ID NO: ; GIP(3-30) [H18K;N24E;K30A],

EGTFISDYSIAMDKIKQQDFVNWLLEQK - Z; SEQ ID NO: ; GIP(3-30) [H18K;A28E],

VGTFISDYSIAMDKIKQQDFVNWLLAQK - Z; SEQ ID NO: ; GIP(3-30) [E3V;H18K],

AibGTFISDYSIAMDKIKQQDFVNWLLAQK - Z; SEQ ID NO: ; GIP(3-30)

[E3Aib;H18K],

PGTFISDYSIAMDKIKQQDFVNWLLAQK - Z; SEQ ID NO: ; GIP(3-30) [E3P;H 18K],

VETFISDYSIAMDKIKQQDFVNWLLAQK - Z; SEQ ID NO: ; GIP(3-30) [E3V;G4E;H18K],

AibETFISDYSIAMDKIKQQDFVNWLLAQK - Z; SEQ ID NO: ; GIP(3-30) [E3Aib;G4E;H18K],

GETFISDYSIAMDKIKQQDFVNWLLAQK - Z; SEQ ID NO: ; GIP(3-30) [E3G;G4E;H18K],

PETFISDYSIAMDKIKQQDFVNWLLAQK - Z; SEQ ID NO: ; GIP(3-30)

[E3P;G4E;H18K],

DTTFISDYSIAMDKIKQQDFVNWLLAQK - Z; SEQ ID NO: ; GIP(3-30) [E3D;G4T;H18K],

GETFISDYAIALDKIKQQDFVEWLLAQG - Z; SEQ ID NO: ; GIP(3-30) [E3G;G4E;S1 1A;M14L;H18K;N24E;K30G],

GETFISTYSIALDKIKQQDFVEWLLAQG - Z; SEQ ID NO: ; GIP(3-30)

[E3G;G4E;D9T;M14L;H18K;N24E],

EGTFISTYKIALDKIHQQDFVEWLLAQK - Z; SEQ ID NO: ; GIP(3-30) [D9T;S1 1 K; M14L;N24E],

EGTFISDYSIAibMDKIKQQDFVEWLLAQK - Z; SEQ ID NO; GIP(3-30)

[A13Aib;H18K;N24E],

EGTFISDYSIAibLDKIKQQDFVEWLLAQK - Z; SEQ ID NO: ; GIP(3-30) [A13Aib;M14L;H18K;N24E],

EGTFISDYSIAibNIeDKIKQQDFVEWLLAQK - Z; SEQ ID NO: ; GIP(3-30) [A13Aib;M14Nle;H18K;N24E],

EGTFISDYSIALDKIKQQDFVEWLLAQK - Z; SEQ ID NO: ; GIP(3-30)

[M14L;H18K;N24E],

EGTFISDYSIANIeDKIKQQDFVEWLLAQK - Z; SEQ ID NO: ; GIP(3-30) [M14Nle;H18K;N24E],

EGTFISDYSIAKDKIKQQDFVEWLLAQK - Z; SEQ ID NO: ; GIP(3-30) [M14K;H18K;N24E],

EGTFISDYSIANIeDKIKQQDFVNWLLAGG - Z; SEQ ID NO: ; GIP(3-30) [M14Nle;H 18K;Q29G;K30G],

EGTFISDYSIANIeDKIKQQDFVEWLLAGG - Z; SEQ ID NO: ; GIP(3-30) [M14Nle;H18K;N24E;Q29G;K30G],

EGTFISEYSIAibLEKIKQQEFVEWLLAQK - Z; SEQ ID NO: ; GIP(3-30) [D9E;A13Aib;M14L;D15E;H18K;D21 E;N24E],

EGTFISEYSIAibNIeEKIKQQEFVEWLLAQK - Z; SEQ ID NO: ; GIP(3-30) [D9E;A13Aib;M14Nle;D15E;H 18K;D21 E;N24E],

yGluGTFISDYSIAMDKIKQQDFVNWLLAQK - Z; SEQ ID NO: ; GIP(3-30) [E3yGlu;H18K],

3GluGTFISDYSIAMDKIKQQDFVNWLLAQK - Z; SEQ ID NO: ; GIP(3-30) [E33Glu;H18K],

XGTFISDYSIAMDKIKQQDFVNWLLAQK - Z; SEQ ID NO: ; GIP(3-30) [E3Glutaric acid(X);H18K],

EGTFISDYSIALDKIKQQDFVEWLLAGG - Z; SEQ ID NO: ; GIP(3-30) [M14L;H18K;N24E;Q29G;K30G],

EGTFISEYSIALEKIKQQEFVEWLLAQK - Z; SEQ ID NO: ; GIP(3-30)

[D9E;M14L;D15E;H18K;D21 E;N24E],

EGTFISEYSIANIeEKIKQQEFVEWLLAQK - Z; SEQ ID NO: ; GIP(3-30) [D9E;M14Nle;D15E;H18K;D21 E;N24E],

yGluGTFISDYSIANIeDKIKQQDFVEWLLAQK - Z; SEQ ID NO: ; GIP(3-30) [E3yGlu(L-isomer);M14Nle;H18K;N24E],

yGluGTFISDYSIANIeDKIKQQDFVEWLLAQK - Z; SEQ ID NO: ; GIP(3-30) [E3yGlu(D-isomer);M14Nle;H18K;N24E],

3GluGTFISDYSIANIeDKIKQQDFVEWLLAQK - Z; SEQ ID NO: ; GIP(3-30) [E33Glu;M14Nle;H18K;N24E],

XGTFISDYSIANIeDKIKQQDFVEWLLAQK - Z; SEQ ID NO: ; GIP(3-30) [E3Glutaric acid(X);M14Nle;H18K;N24E],

3GluGTFISDYSIAibNleDKIKQQDFVNWLLAQK - Z; SEQ ID NO: GIP(3-30) [E33Glu; A13Aib; M14Nle; H18K],

EGTFISDYSIALDKIKQQDFVNWLLEQK - Z; SEQ ID NO: ; GIP(3-30)

[M14L;H18K;A28E],

EGTFISDYSIANIeDKIKQQDFVNWLLEQK - Z; SEQ ID NO: ; GIP(3-30)

[M14Nle;H18K;A28E],

EGTFISDYSIALDKIKQQDFVNWLLEGG - Z; SEQ ID NO: ; GIP(3-30)

[M14L;H18K;A28E;Q29G;K30G],

TFISDYSIAMDKIHQQDFVNWLLAQK-Z; SEQ ID NO: ; GIP(5-30)

TFISDYKIAMDKIHQQDFVNWLLAQK-Z; SEQ ID NO: ; GIP(5-30) [S1 1 K], TFISDYSIAMDKIKQQDFVNWLLAQK-Z; SEQ ID NO: ; GIP(5-30) [H18K],

TFISDYKIAMDRIHQQDFVNWLLAQR - Z; SEQ ID NO: ; GIP(5-30)

[S11 K;K16R;K30R],

TFISDYSKAMDKIHQQDFVNWLLAQK - Z; SEQ ID NO: ; GIP(5-30) [I12K], TFISDYSIAMDKIHQKDFVNWLLAQK - Z; SEQ ID NO: ; GIP(5-30) [Q20K], TFISDYSIAMDKIHQQDFVKWLLAQK - Z; SEQ ID NO: ; GIP(5-30) [N24K], and

FISDYSIAMDKIKQQDFVNWLLAQK - Z; SEQ ID NO: ; GIP(6-30) [H18K],

70. The GIP peptide analogue of any one of the preceding claims, wherein said peptide is C-terminally amidated (-NH2) or C-terminally carboxylated (-COOH).

71. The GIP peptide analogue of any one of the preceding claims, wherein said peptide is C-terminally carboxylated (-COOH).

72. The GIP peptide analogue of any one of the preceding claims, wherein said fatty acid molecule is a straight-chain fatty acid.

73. The GIP peptide analogue according to any of the preceding claims, wherein said fatty acid molecule is a branched fatty acid.

74. The GIP peptide analogue according to any of the preceding claims, wherein said fatty acid molecule is a monoacyl fatty acid molecule, comprising one fatty acid.

75. The GIP peptide analogue according to any of the preceding claims, wherein said fatty acid molecule is a diacyl fatty acid molecule.

76. The GIP peptide analogue according to any of the preceding claims, wherein said fatty acid molecule comprises an acyl group of the formula CH3(CH2)/ICO-, wherein n is in an integer from 4 to 24.

77. The GIP peptide analogue according to any of the preceding claims, wherein said fatty acid molecule comprises one or more acyl groups selected from the group consisting of CH3(CH2)6CO-, CH3(CH2)8CO-, CH3(CH2)IOCO-,

CH3(CH2)I2CO-, CH3(CH2)i4CO-, CH3(CH2)i6CO-, CH3(CH2)i8CO-,

CH3(CH2)2OCO- and CH3(CH2)22CO-.

78. The GIP peptide analogue according to any of the preceding claims, wherein said fatty acid molecule comprises an acyl group selected from the group consisting of CH3(CH2)IOCO- (lauryl, C12), CH3(CH2)I2CO- (myristoyl, C14), CH3(CH2)i4CO- (palmitoyl, C16), CH3(CH2)I6CO- (stearyl, C18), CH3(CH2)I8CO- (arachidyl, C20) and CH3(CH2)2oCO- (behenyl, C22).

79. The GIP peptide analogue according to any of the preceding claims, wherein said fatty acid molecule comprises two acyl groups individually selected from the group consisting of HOOC-CH3(CH2)IOCO- (dodecanoyl, C12), HOOC- CH3(CH2)I2CO- (1-tetradecanoyl, C14), HOOC-CH3(CH2)i4CO- (hexadecanoyl, C16), HOOC-CH3(CH2)i5CO- (15-carboxy-pentadecanoyl, C17), HOOC- CH3(CH2)I6CO- (octadecanoyl, C18), HOOC-CH3(CH2)i7CO- (17-carboxy- heptadecanoyl, C19), HOOC-CH3(CH2)i8CO- (eicosanoyl, C20), HOOC- CH3(CH2)I9CO- (19-carboxy-nonadecanoyl, C21 ) and HOOC-CH3(CH2)2oCO- (behenyl, C22).

80. The GIP peptide analogue according to any of the preceding claims, wherein said fatty acid molecule comprises an acyl group of the formula

COOH(CH2)/ICO- (dicarboxylic acid), wherein n is an integer from 4 to 24.

81. The GIP peptide analogue according to any of the preceding claims, wherein said fatty acid molecule comprises an acyl group selected from the group consisting of COOH(CH2)I4CO-, COOH(CH2)I6CO-, COOH(CH2)I8CO- and COOH(CH2)20CO-.

82. The GIP peptide analogue according to any of the preceding claims, wherein said fatty acid molecule comprises or consists of COOH(CH2)i4CO-.

83. The GIP peptide analogue according to any of the preceding claims, wherein said fatty acid molecule comprises or consists of COOH(CH2)i6CO-.

84. The GIP peptide analogue according to any of the preceding claims, wherein said fatty acid molecule comprises or consists of COOH(CH2)i8CO-.

85. The GIP peptide analogue according to any of the preceding claims, wherein said fatty acid molecule is attached to the epsilon amino group of the side chain of an amino acid residue of said GIP peptide analogue directly.

86. The GIP peptide analogue according to any of the preceding claims, wherein said fatty acid molecule is attached to an amino acid residue via a linker.

87. The GIP peptide analogue according to any of the preceding claims, wherein the fatty acid molecule is attached to an amino acid residue via a linker in such a way that a carboxyl group of the fatty acid molecule forms an amide bond with an amino group of the linker.

88. The GIP peptide analogue according to any of the preceding claims, wherein said linker comprises one or more moieties individually selected from the group consisting of:

a. one or more an a,w-amino acids,

b. one or more amino acids selected from the group consisting of succinic acid, Lys, Glu, Asp,

c. 4-Abu,

d. y-aminobuturic acid

e. a dipeptide, such as a dipeptide wherein the C-terminal amino acid residue is Lys, His or Trp, preferably Lys, and wherein the N- terminal amino acid residue is selected from the group comprising

Ala, Arg, Asp, Asn, Gly, Glu, Gin, lie, Leu, Val, Phe and Pro, such as Gly-Lys,

f. one or more of g-aminobutanoyl (g-aminobutyric acid), y-glutamyl (g-glutamic acid), b-asparagyl, b-alanyl and glycyl, and g. g-glutamic acid - [8-amino-3,6-dioxaoctanoic acid]n (yGlu-AEEAcn), wherein n is an integer between 1 and 50, such as an integer between 1-2, 2-3, 3-4, 4-5, 5-6, 6-7, 7-8, 8-9, 9-10, 10-1 1 , 11-12, 12-13, 13-14, 14-15, 15-20, 20-25, 25-30, 30-35, 35-40, 40-45, 45- 50.

89. The GIP peptide analogue according to any of the preceding claims, wherein said linker comprises one or more moieties individually selected from the group consisting of:

a. oamino acid, y-amino acid or w-amino acid,

b. one or more amino acids selected from the group consisting of succinic acid, Lys, Glu, Asp,

c. one or more of y-aminobutanoyl (y-aminobutyric acid), y-Glu (y-glutamic acid), b-Asp (b-asparagyl), b-Ala (b-alanyl) and Gly, and

d. [8-amino-3,6-dioxaoctanoic acid]n (AEEAcn), wherein n is an integer between 1 and 50, such as an integer between 1-4, 1-3 or 1-2.

90. The GIP peptide analogue of any one of the preceding claims, wherein said linker comprises a y-Glu, one or more 8-amino-3,6-dioxaoctanoic acid (AEEAc), or combinations thereof.

91. The GIP peptide analogue of any one of the preceding claims, wherein said linker comprises or consists of a y-Glu.

92. The GIP peptide analogue of any one of the preceding claims, wherein said linker comprises or consists of a [8-amino-3,6-dioxaoctanoic acid]n (AEEAc)n, wherein n is an integer between 1 and 50, such as an integer between 1-2, 2-3, 3-4, 4-5, 5-6, 6-7, 7-8, 8-9, 9-10, 10-1 1 , 11-12, 12-13, 13-14, 14-15, 15-20, 20- 25, 25-30, 30-35, 35-40, 40-45, 45-50, preferably wherein n is 1 , 2 or 3.

93. The GIP peptide analogue of any one of the preceding claims, wherein said linker comprises or consists of a g-Glu and one AEEAc, such as a g-Glu and two AEEAc, for example a g-Glu and three AEEAc.

94. The GIP peptide analogue of any one of the preceding claims, wherein the fatty acid molecule is attached to an amino acid residue via a linker, and wherein the combination of linker and fatty acid is selected from the group consisting of:

i. Hexadecanoyl-y-Glu- ii. Hexadecanoyl-y-Glu-y-Glu- iii. Hexadecanoyl-y-Glu-AEEAc- iv. Hexadecanoyl-y-Glu-AEEAc-AEEAc- v. H exad eca noy l-y-G I u-AE E Ac-AE E Ac-AE EAc- vi. [15-carboxy-pentadecanoyl]-y-Glu- vii. [15-carboxy-pentadecanoyl]-Y-Glu-y-Glu- viii. [15-carboxy-pentadecanoyl]-y-Glu-AEEAc- ix. [15-carboxy-pentadecanoyl]-y-Glu-AEEAc-AEEAc- x. [15-carboxy-pentadecanoyl]-y-Glu-AEEAc-AEEAc- AEEAc- xi. Octadecanoyl-y-Glu- xii. Octadecanoyl-y-Glu-y-Glu- xiii. Octadecanoyl-y-Glu-AEEAc- xiv. Octadecanoyl-y-Glu-AEEAc-AEEAc- xv. Octad eca noy l-y-G I u-AE E Ac-AE E Ac-AE EAc- xvi. [17-carboxy-heptadecanoyl]-y-Glu- xvii. [17-carboxy-heptadecanoyl]-Y-Glu-y-Glu- xviii. [17-carboxy-heptadecanoyl]-y-Glu-AEEAc- xix. [17-carboxy-heptadecanoyl]-y-Glu-AEEAc-AEEAc- xx. [17-carboxy-heptadecanoyl]-y-Glu-AEEAc-AEEAc- AEEAc- xxi. Eicosanoyl-y-Glu- xxii. Eicosanoyl-y-Glu-y-Glu- xxiii. Eicosanoyl-y-Glu-AEEAc- xxiv. Eicosanoyl-y-Glu-AEEAc-AEEAc- xxv. E icosa noy l-y-G I u-AE E Ac-AE E Ac-AE EAc- xxvi. [19-carboxy-nonadecanoyl]-y-Glu- xxvii. [19-carboxy-nonadecanoyl]-Y-Glu-y-Glu-

xxviii. [19-carboxy-nonadecanoyl]-y-Glu-AEEAc- xxix. [19-carboxy-nonadecanoyl]-y-Glu-AEEAc-AEEAc- xxx. [19-carboxy-nonadecanoyl]-y-Glu-AEEAc-AEEAc- AEEAc-

95. The GIP peptide analogue of any one of the preceding claims, wherein the fatty acid molecule is attached to an amino acid residue via a linker, and wherein the combination of linker and fatty acid is selected from the group consisting of:

i. [15-Carboxy pentadecanoyl-yGlu

ii. [17-carboxy-heptadecanoyl]-y-Glu-AEEAc-AEEAc-, and iii. [17-carboxy-heptadecanoyl]-yGlu-yGlu

96. The GIP peptide analogue of any one of the preceding claims selected from the group consisting of:

EGTFISDYSIAMDKIKQQDFVNWLLAQKGKKNDW-2xAEEAc+y-glu-C16- diacid/K18; SEQ ID NO: GIP(3-36) [H18K],

EGTFISDYSIAMDKIKQQDFVNWLLAQKGKKNDW-3xAEEAc+y-glu-C16- diacid/K18; SEQ ID NO: GIP(3-36) [H18K],

EGTFISDYSIAMDKIKQQDFVNWLLAQKGKKNDW-3xAEEAc+y-glu-C18- diacid/K18; SEQ ID NO: GIP(3-36) [H18K],

EGTFISDYSIAMDKIKQQDFVNWLLAQKPSSGAPPPS-C16-diacid/K18; SEQ

ID NO: GIP(3-30)+Cex(31 -39) [H18K],

EGTFISDYSIAMDKIKQQDFVNWLLAQKPSSGAPPPS(NH2)-2xAEEAc+yGlu- C18-diacid/K18; SEQ ID NO: GIP(3-30)+Cex(31 -39) [CexH18K],

EGTFISDYSIAMDKIKQQDFVNWLLAQKPSSGAPPPS-2xAEEAc+yGlu-C18- diacid/K18; SEQ ID NO: GIP(3-30)+Cex(31 -39) [CexH18K],

EGTFISDYSIAMDKIKQQDFVNWLLAQKPSSGAPPPS(NH2)-2xAEEAc+yGlu- C18-diacid/K18; SEQ ID NO: GIP(3-30)+Cex(31 -39) [CexH 18K],

EGTFISDYSIAMDKIKQQDFVNWLLAQKPSSGAPPPS-C16-diacid/K18; SEQ ID NO: GIP(3-30)+Cex(31 -39) [CexH 18K],

EGTFISDYSIAMDKIKQQDFVNWLLAQKPSSGAPPPS-C18-diacid/K18; SEQ

ID NO: GIP(3-30)+Cex(31 -39) [CexH18K],

EGTFISDYSIAMDKIKQQDFVNWLLAQKPSSGAPPPS-C18/K18; SEQ ID NO: GIP(3-30)+Cex(31 -39) [CexH18K],

EGTFISDYSIAMDKIKQQDFVNWLLAQKPSSGAPPPS-2xAEEAc+yGlu-C16- diacid/K18; SEQ ID NO: GIP(3-30)+Cex(31 -39) [CexH18K],

EGTFISDYSIAMDKIKQQDFVNWLLAQKPSSGAPPPS-yGlu-C16-diacid/K18; SEQ ID NO: GIP(3-30)+Cex(31-39) [CexH18K],

EGTFISDYSIAMDKIKQQDFVNWLLAQKGPSSGAPPPS-C16-diacid/K18; SEQ ID NO: GIP(3-30)+Cex [H18K],

EGTFISDYSIAMDKIKQQDFVNWLLAQKGPSSGAPPPS-2xAEEAc+y-glu-C16-diacid/K18: SEQ ID NO: GIP(3-30)+Cex [CexH18K],

EGTFISDYSIAMDKIKQQDFVNWLLAQKGPSSGAPPPS-3xAEEAc+y-glu-C16-diacid/K18: SEQ ID NO: GIP(3-30)+Cex [CexH18K],

EGTFISDYSIAMDKIKQQDFVNWLLAQKGPSSGAPPPS-2xAEEAc+y-glu-C18-diacid/K18: SEQ ID NO: GIP(3-30)+Cex [CexH18K],

EGTFISDYSIAMDKIKQQDFVNWLLAQKGPSSGAPPPS-3xAEEAc+y-glu-C18-diacid/K18: SEQ ID NO: GIP(3-30)+Cex [CexH18K],

EGTFISDYSIAMDKIKQQDFVNWLLAQKGPSSGAPPPS(NH2)-2xAEEAc+yGlu-C18-diacid/K18; SEQ ID NO: GIP(3-30)+Cex(31-39) [CexH18K),

EGTFISDYSIAMDKIKQQDFVNWLLAQKGPSSGAPPPS-2xAEEAc+yGlu-C18-diacid/K18; SEQ ID NO: GIP(3-30)+Cex(31-39) [CexH18K],

EGTFISDYSIAMDKIKQQDFVNWLLAQKGPSSGAPPP- C16-diacid/K18: SEQ ID NO: GIP(3-30)+Cex(9) [CexH18K],

EGTFISDYSIAMDKIKQQDFVNWLLAQKGPSSGAPP- C16-diacid/K18: SEQ ID NO: Gl P(3-30)+Cex(Cex8) [H18K],

EGTFISDYSIAMDKIKQQDFVNWLLAQKGPSSGAP- C16-diacid/K18: SEQ ID NO: Gl P(3-30)+Cex(Cex7) [H18K],

EGTFISDYSIAMDKIKQQDFVNWLLAQKGPSSGA- C16-diacid/K18: SEQ ID NO: Gl P(3-30)+Cex(Cex6) [H18K],

EGTFISDYSIAMDKIKQQDFVNWLLAQKGPSSG- C16-diacid/K18: SEQ ID NO: GIP(3-30)+Cex(Cex5) [H18K],

EGTFISDYSIAMDKIKQQDFVNWLLAQKGPSS- C16-diacid/K18: SEQ ID NO: GIP(3-30)+Cex(Cex4) [H18K],

EGTFISDYSIAMDKIKQQDFVNWLLAQKGPS- C16-diacid/K18: SEQ ID NO: GIP(3-30)+Cex(Cex3) [H18K],

EGTFISDYSIAMDKIKQQDFVNWLLAQKGP- C16-diacid/K18: SEQ ID NO: GIP(3-30)+Cex(Cex2) [H18K],

EGTFISDYSIAMDKIKQQDFVN WLLAQKG-C16-diacid/K18: SEQ ID NO:

GIP(3-31 ) [H18K],

EGTFISDYSIAMDKIKQQDFVNWLLAQKGK-C16-diacid/K18: SEQ ID NO:

GIP(3-32) [H18K],

EGTFISDYSIAMDKIKQQDFVNWLLAQKGKK-C16-diacid/K18: SEQ ID NO: GIP(3-33) [H18K],

EGTFISDYSIAMDKIKQQDFVNWLLAQKGKKN-C16-diacid/K18: SEQ ID NO: GIP(3-34) [H18K],

EGTFISDYSIAMDKIKQQDFVNWLLAQKGKKND-C16-diacid/K18: SEQ ID NO: GIP(3-35) [H18K],

EGTFISDYSIAMDKIKQQDFVNWLLAQKGKKNDW-C16-diacid/K18: SEQ ID NO: GIP(3-36) [H18K],

EGTFISDYSIAMDKIKQQDFVNWLLAQKGKKNDWK-C16-diacid/K18: SEQ ID

NO: GIP(3-37) [H18K],

EGTFISDYSIAMDKIKQQDFVNWLLAQKGKKNDWKH-C16-diacid/K18: SEQ ID NO: GIP(3-38) [H18K],

EGTFISDYSIAMDKIKQQDFVNWLLAQKGKKNDWKHN-C16-diacid/K18: SEQ ID NO: GIP(3-39) [H18K],

EGTFISDYSIAMDKIKQQDFVNWLLAQKGKKNDWKHNI-C16-diacid/K18: SEQ ID NO: GIP(3-40) [H18K],

EGTFISDYSIAMDKIKQQDFVNWLLAQKGKKNDWKHNIT-C16-diacid/K18:

SEQ ID NO: GIP(3-41 ) [H18K],

EGTFISDYSIAMDKIKQQDFVNWLLAQKGKKNDWKHNITQ-C16-diacid/K18:

SEQ ID NO: GIP(3-42) [H18K],

SGTFISDYSIAMDKIKQQDFVNWLLAQKGKKNDW-2xAEEAc+y-glu-C16-diacid/K18; SEQ ID NO: GIP(3-36) [E3S;H18K],

SGTFISDYSIAMDKIKQQDFVNWLLAQKGKKNDW-3xAEEAc+y-glu-C16-diacid/K18; SEQ ID NO: GIP(3-36) [E3S;H18K],

SGTFISDYSIAMDKIKQQDFVNWLLAQKGKKNDW-3xAEEAc+y-glu-C18-diacid/K18; SEQ ID NO: GIP(3-36) [E3S;H18K],

SGTFISDYSIAMDKIKQQDFVNWLLAQKGPSSGAPPPS-2xAEEAc+y-glu-C16-diacid/K18: SEQ ID NO: GIP(3-30)+Cex [E3S;H18K],

SGTFISDYSIAMDKIKQQDFVNWLLAQKGPSSGAPPPS-3xAEEAc+y-glu-C16-diacid/K18: SEQ ID NO: GIP(3-30)+Cex [CexE3S;H18K],

SGTFISDYSIAMDKIKQQDFVNWLLAQKGPSSGAPPPS-2xAEEAc+y-glu-C18-diacid/K18: SEQ ID NO: GIP(3-30)+Cex [CexE3S;H18K],

SGTFISDYSIAMDKIKQQDFVNWLLAQKGPSSGAPPPS-3xAEEAc+y-glu-C18-diacid/K18: SEQ ID NO: GIP(3-30)+Cex [CexE3S;H18K],

SGTFISDYSIAMDRIKQQDFVNWLLAQRGRRNDW-2xAEEAc+y-glu-C16-diacid/K18; SEQ ID NO: GIP(3-36) [E3S;K16R;H18K;K30R],

SGTFISDYSIAMDRIKQQDFVNWLLAQRGRRNDW-3xAEEAc+y-glu-C16-diacid/K18; SEQ ID NO: GIP(3-36) [E3S;K16R;H18K;K30R],

SGTFISDYSIAMDRIKQQDFVNWLLAQRGRRNDW-3xAEEAc+y-glu-C18-diacid/K18; SEQ ID NO: GIP(3-36) [E3S;K16R;H18K;K30R],

SGTFISDYSIAMDRIKQQDFVNWLLAQRGPSSGAPPPS-2xAEEAc+y-glu-C16-diacid/K18: SEQ ID NO: GIP(3-30)+Cex [E3S;K16R;H18K;K30R],

SGTFISDYSIAMDRIKQQDFVNWLLAQRGPSSGAPPPS-3xAEEAc+y-glu-C18-diacid/K18: SEQ ID NO: GIP(3-30)+Cex [CexE3S;K16R;H18K;K30R],

SGTFISDYSIAMDRIKQQDFVNWLLAQRGPSSGAPPPS-2xAEEAc+y-glu-C16-diacid/K18: SEQ ID NO: GIP(3-30)+Cex [CexE3S;K16R;H18K;K30R],

SGTFISDYSIAMDRIKQQDFVNWLLAQRGPSSGAPPPS-3xAEEAc+y-glu-C18-diacid/K18: SEQ ID NO: GIP(3-30)+Cex [CexE3S;K16R;H18K;K30R],

EGTFISDYKIAMDKIHQQDFVNWLLAQKGKKNDW-2xAEEAc+yGlu- C18-diacid/K1 1 ; SEQ ID NO: GIP(3-36) [S1 1 K],

EGTFISDYSKAMDKIHQQDFVNWLLAQKGKKNDW-2xAEEAc+yGlu- C18-diacid/K12; SEQ ID NO: GIP(3-36) [I12K],

EGTFISDYSIAMDKIHQKDFVNWLLAQKPSSGAPPPS(NH2)-2xAEEAc+yGlu-C18-diacid/K20; SEQ ID NO: GIP(3-30)+Cex(31-39) [CexQ20K],

EGTFISDYSIAMDKKHQQDFVNWLLAQKPSSGAPPPS(NH2)-2xAEEAc+yGlu-C18-diacid/K17; SEQ ID NO: GIP(3-30)+Cex(31-39) [Cexl17K],

EGTFISDYSIAMDKIKQQDFVNWLLAQGPSSGAPPPS(NH2)-2xAEEAc+yGlu-C18-diacid; SEQ ID NO: GIP(3-30)+Cex(31-39) [CexH18K;K30G],

EGTFISDYSIAMDKIKQQDFVNWLLAGGPSSGAPPPS(NH2)-2xAEEAc+yGlu-C18-diacid; SEQ ID NO: GIP(3-30)+Cex(31-39) [CexH18K;Q29G;K30G], EGTFISDYSIAMDKIKQQDFVNWLLAGGPSSGAPPPS-2xAEEAc+yGlu- C18-diacid; SEQ ID NO: GIP(3-30)+Cex(31-39) [CexH18K;Q29G;K30G],

EGTFISEYSIAMEKIKQQEFVQWLLAQKPSSGAPPPS- C16-diacid; SEQ ID NO: GIP(3-30)+Cex(31-39) [CexD9E;D15E;H18K;D21 E;N24Q],

EGTFISEYSIAMEKIKQQDFVEWLLAQKPSSGAPPPS- C16-diacid; SEQ ID NO: GIP(3-30)+Cex(31-39) [D9E;D15E;H18K;N24E],

EGTFISEYSAibANIeEKIKQQDFVEWLLAQKPSSGAPPPS-C16-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31-39) [D9E;l12Aib;M14Nle;D15E;H18K;N24E], EGTFISEYSIAibMEKIKQQDFVEWLLAQKPSSGAPPPS-C16-diacid/18K; SEQ

ID NO: GIP(3-30)+Cex(31 -39) [D9E;A13Aib;D15E;H 18K;N24E],

EGTFISDYSIAMDKIKQQDFVEWLLAQKPSSGAPPPS-C16-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31 -39) [H18K;N24E],

EGTFISDYSIALDKIKQQDFVNWLLAQKPSSGAPPPS-C16-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31 -39) [M14L;H18K],

EGTFISDYSIALDKIKQQDFVNWLLAQKPSSGAPPPS-2xAEEAc+yGlu-C18-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31 -39) [M14L;H18K],

EGTFISDYSIANIeDKIKQQDFVNWLLAQKPSSGAPPPS-C16-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31 -39) [M14Nle;H18K],

EGTFISDYSIAEDKIKQQDFVNWLLAQKPSSGAPPPS-C16-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31 -39) [M14E;H18K],

EGTFISDYSIAKDKIKQQDFVNWLLAQKPSSGAPPPS-C16-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31 -39) [M14K;H18K],

EGTFISDYSIAKDKIKQQDFVNWLLAQKPSSGAPPPS-2xAEEAc+yGlu-C18-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31 -39) [M14K;H18K],

EGTFISDYSIASDKIKQQDFVNWLLAQKPSSGAPPPS-C16-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31 -39) [M14S;H18K],

EGTFISDYSIAMDKIKQQDFVEWLLAQAPSSGAPPPS-C16-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31 -39) [H18K;N24E;K30A],

EGTFISDYSIAMDKIKQQDFVNWLEAQKPSSGAPPPS-C16-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31 -39) [H18K;L27E],

EGTFISDYSIAMDKIKQQDFVNWLLEQKPSSGAPPPS-C16-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31 -39) [H18K;A28E],

VGTFISDYSIAMDKIKQQDFVNWLLAQKPSSGAPPPS-C16-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31 -39) [E3V;H18K],

AibGTFISDYSIAMDKIKQQDFVNWLLAQKPSSGAPPPS-C16-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31 -39) [E3Aib;H18K],

PGTFISDYSIAMDKIKQQDFVNWLLAQKPSSGAPPPS-C16-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31 -39) [E3P;H18K],

VETFISDYSIAMDKIKQQDFVNWLLAQKPSSGAPPPS-C16-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31 -39) [E3V;G4E;H18K],

AibETFISDYSIAMDKIKQQDFVNWLLAQKPSSGAPPPS-C16-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31 -39) [E3Aib;G4E;H18K],

GETFISDYSIAMDKIKQQDFVNWLLAQKPSSGAPPPS-C16-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31 -39) [E3G;G4E;H18K],

PETFISDYSIAMDKIKQQDFVNWLLAQKPSSGAPPPS-C16-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31 -39) [E3P;G4E;H18K],

DTTFISDYSIAMDKIKQQDFVNWLLAQKPSSGAPPPS-C16-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31 -39) [E3D;G4T;H18K],

GETFISDYAIALDKIKQQDFVEWLLAQGPSSGAPPPS-C16-diacid/18K; SEQ ID NO: (GIP(3-30)+Cex(31 -39) [E3G;G4E;S1 1A;M14L;H18K;N24E;K30G], GETFISTYSIALDKIKQQDFVEWLLAQKPSSGAPPPS-C16-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31 -39) [E3G;G4E;D9T;M14L;H18K;N24E],

EGTFISTYKIALDKIHQQDFVEWLLAQKPSSGAPPPS- yGlu-C16-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31 -39) [D9T;S1 1 K; M14L;N24E],

GETFISDYAIALDKIKQQDFVEWLLAQG(NH2)PSSGAPPPS-C16-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31 -39) [E3G; G4E; S1 1A;

M14L;H 18K;N24E;K30G],

EGTFISDYSIAibMDKIKQQDFVEWLLAQKPSSGAPPPS-C16-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31 -39) [A13Aib;H18K;N24E],

EGTFISDYSIAibLDKIKQQDFVEWLLAQKPSSGAPPPS-C16-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31 -39) [A13Aib;M14L;H 18K;N24E],

EGTFISDYSIAibLDKIKQQDFVEWLLAQKPSSGAPPPS-2xAEEAc+yGlu-C18-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31 -39) [A13Aib;M14L;H 18K;N24E], EGTFISDYSIAibNleDKIKQQDFVEWLLAQKPSSGAPPPS-C16-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31 -39) [A13Aib;M14Nle;H18K;N24E],

EGTFISDYSIAibNleDKIKQQDFVEWLLAQKPSSGAPPPS-2xAEEAc+yGlu-C18-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31 -39)

[A13Aib;M14Nle;H18K;N24E],

EGTFISDYSIALDKIKQQDFVEWLLAQKPSSGAPPPS-C16-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31 -39) [M14L;H18K;N24E],

EGTFISDYSIALDKIKQQDFVEWLLAQKPSSGAPPPS-2xAEEAc+yGlu-C18-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31 -39) [M14L;H18K;N24E],

EGTFISDYSIANIeDKIKQQDFVEWLLAQKPSSGAPPPS-C16-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31 -39) [M14Nle;H 18K;N24E],

EGTFISDYSIANIeDKIKQQDFVEWLLAQKPSSGAPPPS-2xAEEAc+yGlu-C18-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31 -39) [M14Nle;H18K;N24E], EGTFISDYSIAKDKIKQQDFVEWLLAQKPSSGAPPPS-C16-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31 -39) [M14K;H18K;N24E],

EGTFISDYSIANIeDKIKQQDFVNWLLAGGPSSGAPPPS-C16-diacid/18K; SEQ

ID NO: GIP(3-30)+Cex(31 -39) [M14Nle;H 18K;Q29G;K30G],

EGTFISDYSIANIeDKIKQQDFVEWLLAGGPSSGAPPPS-C16-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31 -39) [M14Nle;H18K;N24E;Q29G;K30G],

EGTFISEYSIAibLEKIKQQEFVEWLLAQKPSSGAPPPS-C16-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31 -39) [D9E;A13Aib;M14L;D15E;H18K;D21 E;N24E], EGTFISEYSIAibLEKIKQQEFVEWLLAQKPSSGAPPPS-2xAEEAc+yGlu-C18-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31 -39)

[D9E;A13Aib;M14L;D15E;H18K;D21 E;N24E],

EGTFISEYSIAibNleEKIKQQEFVEWLLAQKPSSGAPPPS-C16-diacid/18K;

SEQ ID NO: GIP(3-30)+Cex(31 -39)

[D9E;A13Aib;M14Nle;D15E;H18K;D21 E;N24E],

EGTFISEYSIAibNleEKIKQQEFVEWLLAQKPSSGAPPPS-2xAEEAc+yGlu-C18-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31 -39)

[D9E;A13Aib;M14Nle;D15E;H18K;D21 E;N24E],

yGluGTFISDYSIAMDKIKQQDFVNWLLAQKPSSGAPPPS-C16-diacid/18K;

SEQ ID NO: GIP(3-30)+Cex(31 -39)

[E3yGlu;H18K], GluGTFISDYSIAMDKIKQQDFVNWLLAQKPSSGAPPPS-C16-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31 -39) [E33Glu;H18K],

XGTFISDYSIAMDKIKQQDFVNWLLAQKPSSGAPPPS-C16-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31 -39) [E3Glutaric acid(X);H18K],

EGTFISDYSIALDKIKQQDFVEWLLAGGPSSGAPPPS-2xAEEAc+yGlu-C18-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31 -39)

[M14L;H18K;N24E;Q29G;K30G],

EGTFISEYSIALEKIKQQEFVEWLLAQKPSSGAPPPS-2xAEEAc+yGlu-C18-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31 -39)

[D9E;M14L;D15E;H18K;D21 E;N24E],EGTFISEYSIANIeEKIKQQEFVEWLLAQ KPSSGAPPPS-2xAEEAc+yGlu-C18-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31 -39) [D9E;M14Nle;D15E;H18K;D21 EN24E],

yGluGTFISDYSIANIeDKIKQQDFVEWLLAQKPSSGAPPPS-C16-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31 -39) [E3yGlu(L-isomer);M14Nle;H18K;N24E], yGluGTFISDYSIANIeDKIKQQDFVEWLLAQKPSSGAPPPS-C16-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31 -39) [E3yGlu(D-isomer);M14Nle;H18K;N24E], GluGTFISDYSIANIeDKIKQQDFVEWLLAQKPSSGAPPPS-C16-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31 -39) [E33Glu;M14Nle;H18K;N24E],

pGluGTFISDYSIANIeDKIKQQDFVEWLLAQKPSSGAPPPS-2xAEEAc+yGlu-

C18-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31-39)

[E33Glu;M14Nle;H18K;N24E],

XGTFISDYSIANIeDKIKQQDFVEWLLAQKPSSGAPPPS-C16-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31-39) [E3Glutaric acid(X);M14Nle;H18K;N24E], XGTFISDYSIANIeDKIKQQDFVEWLLAQKPSSGAPPPS-2xAEEAc+yGlu-C18-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31-39) [E3Glutaric

acid(X);M14Nle;H18K;N24E],

GluGTFISDYSIAibNleDKIKQQDFVNWLLAQKPSSGAPPPS-C16-diacid/18K; SEQ ID NO: GIP(3-30)+Cex(31-39) [E33Glu;A13Aib;M14Nle;H18K],

EGTFISDYSIAMDKIKQQDFVNWLLAQPSSGAPPPS(NH2)-2xAEEAc+yGlu-C18-diacid/K18; SEQ ID NO: ; GIP(3-30)+Cex(32-39) [H18K;Q29G;K30P]), EGTFISDYSIALDKIKQQDFVNWLLEQKPSSGAPPPS-2xAEEAc+yGlu-C18-diacid/K18; SEQ ID NO: ; GIP(3-30)Cex(31-39) [M14L;H18K;A28E],

EGTFISDYSIANIeDKIKQQDFVNWLLEQKPSSGAPPPS-2xAEEAc+yGlu- C18-diacid/K18; SEQ ID NO: ; GIP(3-30)Cex(31-39) [M14Nle;H18K;A28E], and EGTFISDYSIALDKIKQQDFVNWLLEGGPSSGAPPPS-2xAEEAc+yGlu-C18-diacid/K18; SEQ ID NO: ; GIP(3-30)Cex(31-39) [M14L;H18K;A28E;

Q29G;K30G],

EGTFISDYSIAMDKIKQQDFVNWLLAQK(NH2)PSSGAPPPS C16-diacid/18K; GIP(3-30+CEX31-39 [H18K],

EGTFISDYSIAMDKIKQQDFVNWLLEGGPSSGAPPPS- C16-diacid/K18;

GIP(3-30)+Cex(31-39)

TFISDYKIAMDKIHQQDFVNWLLAQKGKK-y-glu- C16diacid/K1 1 SEQ ID NO: (5-33 S11 K),

TFISDYKIAMDKIHQQDFVNWLLAQKGKKNDW-y-glu- C16diacid/K11 SEQ ID NO: (5-36 S1 1 K),

TFISDYKIAMDKIHQQDFVNWLLAQKGKKNDW-2xAEEAc+yGlu- C18-diacid/K11 , SEQ ID NO: (5-36 S1 1 K),

TFISDYKIAMDKIHQQDFVNWLLAQKGKKNDW(NH2)-2xAEEAc+yGlu- C18-diacid/K11 , SEQ ID NO: (5-36 S1 1 K),

TFISDYKIAMDKIHQQDFVNWLLAQKGKKNDW-2xAEEAc+yGlu-C18 /K1 1 , SEQ ID NO: (5-36 S1 1 K),

TFISDYKIAMDKIHQQDFVNWLLAQKGKKNDW- yGlu-yGlu-C18 /K11 , SEQ ID NO: (5-36 S1 1 K),

TFISDYSKAMDKIHQQDFVNWLLAQKGKKNDW-2xAEEAc+yGlu-

C18diacid/K12 SEQ ID NO: (5-36 I12K),

TFISDYKIAMDKIHQQDFVNWLLAQKGKKNDWKHN-y-glu- C16diacid/K1 1 SEQ ID NO: (5-39 S1 1 K),

TFISDYKIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ-y-glu- C16diacid/K1 1 SEQ ID NO: (5-42 S1 1 K),

TFISDYKIAMDKIHQQDFVNWLLAQKG-y-glu- C16diacid/K1 1 SEQ ID NO: (5-31 S1 1 K),

TFISDYKIAMDKIHQQDFVNWLLAQKGK-y-glu- C16diacid/K1 1 SEQ ID NO: (5-32 S1 1 K),

TFISDYKIAMDKIHQQDFVNWLLAQKGKKN-y-glu- C16diacid/K1 1 SEQ ID NO: (5-34 S1 1 K),

TFISDYKIAMDKIHQQDFVNWLLAQKGKKND-y-glu- C16diacid/K1 1 SEQ ID NO: (5-35 S1 1 K),

TFISDYKIAMDKIHQQDFVNWLLAQKGKKNDWK-y-glu- C16diacid/K1 1 SEQ ID NO: (5-37 S1 1 K),

TFISDYKIAMDKIHQQDFVNWLLAQKGKKNDWKH-y-glu- C16diacid/K1 1 SEQ ID NO: (5-38 S1 1 K),

TFISDYKIAMDKIHQQDFVNWLLAQKGKKNDWKHNI-y-glu- C16diacid/K1 1 SEQ ID NO: (5-40 S1 1 K),

TFISDYKIAMDKIHQQDFVNWLLAQKGKKNDWKHNIT-y-glu- C16diacid/K1 1 SEQ ID NO: (5-41 S1 1 K),

TFISDYKIAMDKIHQQDFVNWLLAQK PSSGAPPPS(NH2)-2xPEG+yGlu- C18-diacid/K1 1 ; SEQ ID NO: (5-30+Cex31 -39 S1 1 K),

TFISDYKIAMDRIHQQDFVNWLLAQRGRRNDW-3xAEEAc+y-glu-C16diacid/K1 1 ; SEQ ID NO: (5-36 S1 1 K K16R K30R K32R K33R),

TFISDYKIAMDRIHQQDFVNWLLAQRGRRNDW-3xAEEAc+y-glu-C18diacid/K1 1 ; SEQ ID NO: (5-36 S1 1 K K16R K30R K32R K33R),

TFISDYKIAMDRIHQQDFVNWLLAQRGPSSGAPPPS-2xAEEAc+y-glu-C16diacid/K1 1 ; SEQ ID NO: (5-30+Cex S1 1 K K16R K30R),

TFISDYKIAMDRIHQQDFVNWLLAQRGPSSGAPPPS-3xAEEAc+y-glu-C16diacid/K1 1 ; SEQ ID NO: (5-30+Cex S1 1 K K16R K30R),

TFISDYKIAMDRIHQQDFVNWLLAQRGPSSGAPPPS-2xAEEAc+y-glu-C18diacid/K1 1 ; SEQ ID NO: (5-30+Cex S1 1 K K16R K30R),

TFISDYKIAMDRIHQQDFVNWLLAQRGPSSGAPPPS-3xAEEAc+y-glu-C18diacid/K1 1 ; SEQ ID NO: (5-30+Cex S1 1 K K16R K30R),

TFISDYSIAMDKIKQQDFVNWLLAQKGKKNDW-2xAEEAc+y-glu- C18diacid/K18; SEQ ID NO: (5-36 H18K),

TFISDYSIAMDKIKQQDFVNWLLAQKPSSGAPPPS(NH2)- 2xPEG+yGlu- C18- diacid/K18; SEQ ID NO: (5-30+Cex31-39 H18K),

TFISDYSIAMDKIKQQDFVNWLLAQKPSSGAPPPS-yGlu- C16-diacid/K18;

SEQ ID NO: (5-30+Cex31-39 H18K),

TFISDYSIAMDKIHQKDFVNWLLAQKGKKNDW-2xAEEAc+y-glu- C18diacid/K20; SEQ ID NO: (5-36 Q20K),

TFISDYSIAMDKIHQKDFVNWLLAQKGKKNDW(NH2)-2xAEEAc+y-glu- C18diacid/K20; SEQ ID NO: (5-36 Q20K),

TFISDYSIAMDKIHQQDFVKWLLAQKGKKNDW-2xAEEAc+y-glu- C18diacid/K24; SEQ ID NO: (5-36 N24K),

TFISDYKIAMDKIHQQDFVNWLLAGGPSSGAPPPS(NH2)-2xPEG+yGlu- C18- diacid/K11 ; SEQ ID NO: GIP(5-30)+Cex(31-39) [S1 1 K;Q29G;K30G],

TFISDYKIAMDKIHQQDFVNWLLAQKPSSGAPPPS(NH2) 2xPEG+yGlu- C18- diacid/K1 1 AT632,

FISDYSIAMDKIKQQDFVNWLLAQKGKK-C16diacid/K18; SEQ ID NO: (6-33 H18K),

FISDYSIAMDKIKQQDFVNWLLAQKGKKNDW-C16diacid/K18; SEQ ID NO: (6- 36 H18K), and

FISDYSIAMDKIKQQDFVNWLLAQKGKKNDWKHN-C16diacid/K18; SEQ ID NO: (6-39 H18K).

97. The GIP peptide analogue according to any of the preceding claims for use in a method of inhibiting or reducing one or more of i) GIP-induced glucagon secretion, ii) GIP-induced insulin secretion, iii) GIP-induced somatostatin secretion, iv) GIP-induced glucose uptake, v) GIP-induced fatty acid synthesis and/or fatty acid incorporation, vi) high or increased expression or activity of a GIPR, vii) post-prandial GIP release, viii) serum levels of free fatty acids and/or triglycerides, ix) GIP-induced appetite increases, x) GIP-induced reduction in energy expenditure, xi) GIP-induced increase in absorption of nutrients from the gut, xii) GIP-induced decrease in GLP-Ts appetite suppressive effect, xiii) GIP- induced leptin resistance..

98. The GIP peptide analogue according to any of the preceding claims for use in a method of treating a condition selected from the group consisting of metabolic syndrome, obesity, pre-diabetes, type I diabetes, type 2 diabetes, insulin resistance, elevated fasting glucose, hyperglycemia, elevated fasting serum triglyceride levels, low levels of very low-density lipoprotein (VLDL) , low high- density lipoprotein (HDL) levels, dyslipidemia, increased/decreased low-density lipoprotein (LDL), high cholesterol levels, abnormal deposition of lipids, a cardiovascular disease, elevated blood pressure and atherosclerosis.