Certains contenus de cette application ne sont pas disponibles pour le moment.
Si cette situation persiste, veuillez nous contacter àObservations et contact
1. (WO2018124398) POLYMÈRE MULTIMÈRE ET MULTIVALENT COMPRENANT UN DOMAINE DE QUEUE HYDROPHOBE D'UNE PROTÉINE VLRB DÉRIVÉE DE LA MYXINE
Document

명세서

발명의 명칭

기술분야

1  

배경기술

2   3   4   5   6   7  

발명의 상세한 설명

기술적 과제

8  

과제 해결 수단

9   10   11   12   13   14   15  

발명의 효과

16  

도면의 간단한 설명

17   18   19   20   21   22   23   24   25  

발명의 실시를 위한 최선의 형태

26   27   28   29   30   31   32   33   34   35   36   37   38   39   40   41   42   43   44   45   46   47   48   49   50   51   52   53   54   55   56   57   58   59   60   61   62   63   64   65   66   67   68   69   70   71   72   73   74   75   76   77   78   79   80   81   82   83   84   85   86   87   88   89  

청구범위

1   2   3   4   5   6   7   8   9   10   11  

도면

1   2   3   4   5   6   7   8   9  

명세서

발명의 명칭 : 먹장어 유래 VLRB 단백질의 소수성 테일 도메인을 포함하는 다량체 다가 중합체

기술분야

[1]
본 발명은 먹장어 유래 VLRB 단백질의 소수성 테일 도메인을 포함하는 다량체 다가 중합체에 관한 것이다.

배경기술

[2]
특정 단백질-단백질 상호 작용, 예를 들어, 항원-항체를 기반으로 하는 단백질 검출 기술에 있어서 중요한 요소는 단백질 탐침(probe)의 활성화 및 표적물질과의 특이적 결합 능력을 유지하는 것이다. 다양한 종류의 단백질 칩 고체 기판 표면에 단백질을 접착하는 기존의 방법은 단순 흡착/확산 또는 단백질의 일차 아민 그룹의 공유결합에 의한 고정화 또는 그것을 기반으로 한 방법이 많다. 그러나 단백질은 일반적으로 기판 표면 위에서 무작위적으로 접착되고, 단백질의 구조가 쉽게 변형되므로 단백질의 활성이 저해되며, 이로 인해 표면 물질과의 결합이 불가능해져 특이적 결합이 효율적이지 못한 큰 문제점이 있다. 또한 단순 흡착으로 기판 표면에 단백질 탐침이 고정화된 경우, 검출 과정 중 강도 높은 세척 조건으로 단백질 탐침이 씻겨나가거나 기판 표면에 더 높은 친화력을 가지는 다른 분자로 전이될 수 있으며, 무엇보다도 단백질 칩 기판 표면에 고정화되는 단백질 탐침의 정량적 제어와 활성화 유지가 어렵다는 큰 문제점이 있다.
[3]
인위적으로 합성되는 기존의 유·무기 나노입자 (금속 나노입자)와는 달리, 단백질 나노입자는 생명체의 세포내에서 자가조립에 의해 합성되는 나노소재로서, 균일한 입도 분포 및 안정성을 확보하고 있음은 물론, 미생물 세포 내에서도 손쉽게 경제적 대량생산이 가능한 소재이다. 또한 유전공학적 표면 개질을 통해 다양한 특성/기능을 가진 단백질 나노입자로 개발할 수 있으며, 특히 표면에 질환 마커 검출 펩타이드 또는 단백질(질환 마커 검출용 탐침)을 표출시켰을 때 일정한 배향성과 높은 직접도 및 구조적 안정성을 확보할 수 있다는 장점을 가지고 있어 고감도 진단시스템을 위한 탐침(probe) 소재로 활용되고 있다.
[4]
그러나 기존에 보고된 단백질 3차원 나노구조체를 만드는 기술은 pH 조건이 산성이거나 제조 온도가 고온이거나 하는 등의 제조 조건이 단백질에는 적합하지 않고, 또한 쌓아올리는 재료물질에 특별한 화학적 처리가 필요하고, 공정시간이 상대적으로 긴 문제점이 있었다.
[5]
한편, 제일 하위 척추동물인 무악류인 칠성장어(lamprey)와 먹장어(hagfish)에서 동정된 VLR(Variable lymphocyte receptor)은 LRR(leucine-rich repeat) 모듈을 1~12개를 재배열(somatic rearrangement)하여 만들어진 폴리펩타이드로 항체처럼 적응면역 기능을 한다. 이는 multi-domain 결합체로 형성되는 분자량이 큰(면역글로불린의 경우 약 150 kDa) 유악류 유래 항원 수용체에 비해 크기가 작은 단일 폴리펩타이드로 현재까지 발견된 면역글로불린 구조를 사용하지 않는 유일한 항원 수용체로 기존의 항체 대용물질이 될 수 있다.
[6]
근래 들어 VLR 동정 및 분리 이후 기존의 항체 대용 물질로 유용하기 위해서 특정 항원에 결합하는 VLR 단백질을 쉽고 빠르게, 대량으로 만들 수 있는 방법 개발이 이루어지고 있다.
[7]
한편, 한국공개특허 제2015-0037959호에는 '단량체 및 다량체 분자의 제조 방법 및 이의 용도'가 개시되어 있고, 한국등록특허 제1587386호에는 '인 비보 이미징을 위한 재조합 형광 단백질 나노입자'가 개시되어 있으나, 본 발명의 먹장어 유래 VLRB 단백질의 소수성 테일 도메인을 포함하는 다량체 다가 중합체에 대해서는 기재된 바가 없다.

발명의 상세한 설명

기술적 과제

[8]
본 발명은 상기와 같은 요구에 의해 도출된 것으로서, 본 발명자들은 먹장어 VLRB(variable lymphocyte receptor B) 단백질의 단량체가 서로 뭉쳐서 대략 1,700~650 kDa 크기의 다량체를 형성하는 것을 확인하였고, 이러한 현상은 VLRB 단백질의 카복시-말단 부분 소수성 테일(hydrophobic tail, hydrophobic clustering, HC)이 정중앙에 코아를 형성하여 구형의 다량체 구조의 항체를 형성함을 확인함으로써, 본 발명을 완성하였다.

과제 해결 수단

[9]
상기 과제를 해결하기 위해, 본 발명은 먹장어 유래 VLRB(variable lymphocyte receptor B) 단백질의 소수성 테일 도메인 및 목적 단백질을 포함하며, 자가조립에 의해 구형의 나노입자를 형성하는 것을 특징으로 하는 다가 중합체를 제공한다.
[10]
또한, 본 발명은 상기 다가 중합체를 코딩하는 핵산을 제공한다.
[11]
또한, 본 발명은 상기 핵산을 포함하는 재조합 발현 벡터를 제공한다.
[12]
또한, 본 발명은 상기 재조합 발현 벡터로 형질전환된 숙주 세포를 제공한다.
[13]
또한, 본 발명은 상기 재조합 발현 벡터로 형질전환된 숙주 세포로부터 구형의 나노입자를 형성하는 다가 중합체를 수득하는 단계를 포함하는, 구형의 나노입자를 형성하는 다가 중합체의 제조방법을 제공한다.
[14]
또한, 본 발명은 상기 재조합 발현 벡터로 형질전환된 숙주 세포로부터 상기 다가 중합체를 세포 표면에 발현시키는 단계를 포함하는, 다가 중합체를 세포 표면에 발현시키는 방법을 제공한다.
[15]
또한, 본 발명은 먹장어 유래 VLRB 단백질의 소수성 테일 도메인을 유효성분으로 함유하는 다가 중합체의 구형의 나노입자 제조용 조성물을 제공한다.

발명의 효과

[16]
본 발명의 먹장어 유래 VLRB 단백질의 소수성 테일 도메인을 포함한 다가 중합체는 자가조립에 의해 나노 크기의 구형을 이루어 탐침 효과를 나타내며 이를 통해 고감도 단백질 나노 칩 개발과 진단 키트 개발에 유용하게 사용될 수 있다.

도면의 간단한 설명

[17]
도 1은 칠성장어(lamprey)의 VLRB 단백질(A) 및 먹장어(hagfish)의 VLRB 단백질(B) 구조를 비교한 결과이다. SP, 시그널 펩타이드; LRRNT, N-terminal capped LRR; LRR, leucine-rich repeat; LRRVs, variable LRR modules; CP, 연결 펩타이드; LRRCT, C-terminal capped LRR; LC, 칠성장어 카복시 말단; HC, 먹장어 카복시 말단; 아미노산 서열 내 회색 표시, 소수성 아미노산.
[18]
도 2는 먹장어 혈장에서의 VLRB 단백질을 확인한 결과이다. A, native-PAGE 또는 SDS-PAGE를 통한 VLRB 단백질의 웨스턴 블롯팅 결과; B, 다양한 농도의 SDS로 처리한 혈장 단백질로부터 VLRB 단백질의 웨스턴 블롯팅 결과; C, 먹장어 혈장 시료의 단백질 크기에 따른 분획 및 각 분획물로부터 분리되는 VLRB 단백질의 닷 블롯팅 결과; D, 각 분획물로부터 분리되는 VLRB 단백질의 웨스턴 블롯팅 결과.
[19]
도 3은 먹장어 혈장 시료의 분획물 표준 시료의 용출 시간별 분자량 곡선(A) 및 각 분획물 내 용출된 VLRB 복합체의 추정되는 모노머 개수를 나타낸 결과(B)이다.
[20]
도 4는 FPLC를 통해 사이즈로 분리된 VLRB 분획물 중 메이저 집단(major population)으로 분리된 16분, 17분 분획물들을 Negatively stained TEM으로 실제 VLRB 이미지를 분석한 결과(A) 및 VLRB 특이 항체인 11G5를 이용하고 금 표지된(gold labeling) 2차 항체로 VLRB를 검출하여 검증한 결과(B)이다.
[21]
도 5는 RFP-stalk 말단에 먹장어 C-말단 절편(30개 아미노산)을 크기별로(5, 6, 7, 8, 9, 10, 15, 20, 25, 30) 융합시켜 293-F 세포주에 발현시킨 재조합 단백질의 native-PAGE(A) 또는 SDS-PAGE(B)를 통한 VLRB 단백질의 웨스턴 블롯팅 결과이다.
[22]
도 6은 RFP, RFP-stalk 또는 RFP-stalk-HC를 발현하는 세포외막에서의 재조합 단백질 발현 위치 여부를 유세포 분석을 통해 확인한 결과이다.
[23]
도 7은 RFP-stalk 또는 RFP-stalk-HC를 293-F 세포주에서 발현시킨 후 포스포리파제 C(phospholipase C, PLC) 효소를 1 unit/ml, 3 unit/ml 농도별로 처리하였을 때 세포막 외부에 GPI linkage로 연결된 RFP-stalk-HC 단백질의 결합이 가수분해되는 것을 유세포 분석을 통해 확인한 결과이다.
[24]
도 8은 RFP-stalk 또는 RFP-stalk-HC를 발현하는 세포에서의 재조합 단백질 발현 위치를 면역세포화학분석을 통해 확인한 결과이다.
[25]
도 9는 먹장어 VLRB, 칠성장어 VLRB 및 면역글로불린 항체의 구조를 비교한 유연관계를 나타낸다.

발명의 실시를 위한 최선의 형태

[26]
본 발명의 목적을 달성하기 위하여, 본 발명은 먹장어 유래 VLRB(variable lymphocyte receptor B) 단백질의 소수성 테일 도메인 및 목적 단백질을 포함하며, 자가조립에 의해 구형의 나노입자를 형성하는 것을 특징으로 하는 다가 중합체를 제공한다.
[27]
상기 먹장어 유래 VLRB 단백질의 소수성 테일 도메인은 서열번호 1의 아미노산 서열을 갖는 폴리펩타이드 및 이의 기능적 동등물을 포함한다. "기능적 동등물"이란 아미노산의 부가, 치환 또는 결실의 결과, 상기 서열번호 1의 아미노산 서열과 적어도 70% 이상, 바람직하게는 80% 이상, 더욱 바람직하게는 90% 이상, 더 더욱 바람직하게는 95% 이상의 서열 상동성을 갖는 것으로, 서열번호 1로 표시되는 단백질과 실질적으로 동질의 활성을 나타내는 단백질을 말한다. "실질적으로 동질의 활성"이란 자가조립에 의해 구형의 나노입자를 형성하는 활성을 의미한다.
[28]
본 발명에서 '목적 단백질'은 당업자가 생산하고자 하는 단백질로서, 재조합 발현벡터에 상기 단백질을 코딩하는 폴리뉴클레오티드를 삽입하여 형질전환체에서 발현할 수 있는 모든 단백질을 의미한다.
[29]
본 발명에서 목적 단백질은 당업자가 원하는 모든 단백질이 가능하며, 예를 들어 VLR, 효소, 항체, 항원 혹은 그 일부분, 단쇄항체, 세포수용체, 결합단백질, 결합도메인, 펩타이드, 부착단백질, 구조단백질, 조절단백질, 독소단백질, 사이토카인, 전사조절인자, 혈액응고인자 및 식물 생체방어 유도 단백질로 이루어진 군에서 선택되는 생물학적 활성을 갖는 다양한 외래단백질을 목적단백질로 할 수 있으나, 이에 제한되지 않는다.
[30]
상기 구형의 나노입자는 내부에 먹장어 유래 VLRB 단백질의 소수성 테일 도메인이 위치하고 목적 단백질이 외부로 돌출되는 구조를 갖는 것을 특징으로 한다.
[31]
본 발명의 일 구현예에 따르면 본 발명의 다가 중합체는 자가 조립에 의하여 구형 나노입자를 형성하며 크기 배제 크로마토그래피 및 정량분석을 통하여 나노입자 당 16~42개 목적 단백질을 가질 수 있음을 확인하였다. 또한 전자 현미경 관찰을 통해 본 발명의 다가 중합체가 22~25 nm의 직경을 가진 구형 나노입자를 형성함을 확인하였다.
[32]
본 발명에서 '다가 중합체'는 원래의 목적 단백질의 서열의 아미노 말단(N-말단) 또는 카복시 말단(C-말단)에 다른 단백질이 연결되거나 다른 아미노산이 부가되어 하나의 폴리펩타이드로 발현되는 단백질을 의미한다.
[33]
상기 먹장어 유래 VLRB 단백질의 소수성 테일 도메인은 목적 단백질의 C-말단에 직접적으로 또는 간접적으로 융합될 수 있으나, 이에 제한되지 않는다. 바람직하게는 먹장어 유래 VLRB 단백질의 소수성 테일 도메인은 목적 단백질의 C-말단에 융합될 수 있다.
[34]
또한, 본 발명은 상기 다가 중합체를 코딩하는 핵산을 제공한다.
[35]
또한, 본 발명은 상기 다가 중합체를 코딩하는 핵산을 포함하는 재조합 발현 벡터 및 상기 재조합 발현 벡터로 형질전환된 숙주 세포를 제공한다.
[36]
용어 "재조합"은 세포가 이종의 핵산을 복제하거나, 상기 핵산을 발현하거나 또는 펩티드, 이종의 펩티드 또는 이종의 핵산에 의해 암호된 단백질을 발현하는 세포를 지칭하는 것이다. 재조합 세포는 상기 세포의 천연 형태에서는 발견되지 않는 유전자 또는 유전자 절편을, 센스 또는 안티센스 형태 중 하나로 발현할 수 있다. 또한 재조합 세포는 천연 상태의 세포에서 발견되는 유전자를 발현할 수 있으며, 그러나 상기 유전자는 변형된 것으로서 인위적인 수단에 의해 세포 내 재도입된 것이다.
[37]
용어 "재조합 발현 벡터"는 세균 플라스미드, 파아지, 효모 플라스미드, 식물 세포 바이러스, 포유동물 세포 바이러스, 또는 다른 벡터를 의미한다. 대체로, 임의의 플라스미드 및 벡터는 숙주 내에서 복제 및 안정화할 수 있다면 사용될 수 있다. 상기 발현 벡터의 중요한 특성은 복제 원점, 프로모터, 마커 유전자 및 번역 조절 요소(translation control element)를 가지는 것이다.
[38]
본 발명의 다가 중합체를 코딩하는 유전자 서열 및 적당한 전사/번역 조절 신호를 포함하는 발현 벡터는 당업자에 주지된 방법에 의해 구축될 수 있다. 상기 방법은 시험관 내 재조합 DNA 기술, DNA 합성 기술 및 생체 내 재조합 기술 등을 포함한다. 상기 DNA 서열은 mRNA 합성을 이끌기 위해 발현 벡터 내의 적당한 프로모터에 효과적으로 연결될 수 있다. 또한 발현 벡터는 번역 개시 부위로서 리보좀 결합 부위 및 전사 터미네이터를 포함할 수 있다.
[39]
본 발명의 벡터를 원핵세포에 안정되면서 연속적으로 클로닝 및 발현시킬 수 있는 숙주세포는 당업계에 공지된 어떠한 숙주세포도 이용할 수 있으며, 예컨대, 대장균( E. coli) Rosetta, 대장균 JM109, 대장균 BL21, 대장균 RR1, 대장균 LE392, 대장균 B, 대장균 X 1776, 대장균 Dα, 대장균 W3110, 바실러스 서브틸리스, 바실러스 츄린겐시스와 같은 바실러스 속 균주, 살모넬라 티피무리움, 세라티아 마르세슨스 및 다양한 슈도모나스 종과 같은 장내균과 균주 등이 있다.
[40]
또한, 본 발명의 벡터를 진핵 세포에 형질전환시키는 경우에는 숙주세포로서, 효모( Saccharomyce cerevisiae), 곤충세포, 사람세포 및 동물세포(예컨대, CHO(Chinese hamster ovary), W138, BHK, COS-7, 293, HepG2, 3T3, RIN 및 MDCK 세포주) 및 식물세포 등이 이용될 수 있다.
[41]
또한, 본 발명은
[42]
1) 상기 다가 중합체를 코딩하는 핵산을 포함하는 재조합 발현 벡터를 제작하는 단계;
[43]
2) 상기 재조합 발현 벡터로 형질전환된 숙주 세포를 배양하는 단계; 및
[44]
3) 상기 배양한 숙주 세포로부터 구형의 나노입자를 형성하는 다가 중합체를 수득하는 단계를 포함하는, 구형의 나노입자를 형성하는 다가 중합체의 제조방법을 제공한다.
[45]
또한, 본 발명은
[46]
1) 상기 다가 중합체를 코딩하는 핵산을 포함하는 재조합 발현 벡터를 제작하는 단계;
[47]
2) 상기 재조합 발현 벡터로 형질전환된 숙주 세포를 배양하는 단계; 및
[48]
3) 상기 배양한 숙주 세포로부터 상기 다가 중합체를 세포 표면에 발현시키는 단계를 포함하는, 상기 다가 중합체를 세포 표면에 발현시키는 방법을 제공한다.
[49]
또한, 본 발명은 먹장어 유래 VLRB 단백질의 소수성 테일 도메인을 유효성분으로 함유하는 다가 중합체의 구형의 나노입자 제조용 조성물을 제공한다. 본 발명의 다가 중합체의 구형의 나노입자 제조용 조성물은 먹장어 유래 VLRB 단백질의 소수성 테일 도메인을 유효성분으로 함유하며, 상기 소수성 테일 도메인에 목적 단백질을 결합시켜 목적 단백질의 구형의 나노입자를 형성할 수 있는 것이다.
[50]
[51]
이하, 본 발명을 실시예에 의해 상세히 설명한다. 단 하기 실시예는 본 발명을 예시하는 것일 뿐, 본 발명의 내용이 하기 실시예에 한정되는 것은 아니다.
[52]
[53]
재료 및 방법
[54]
1. 실험동물 및 세포
[55]
20~30cm 크기의 먹장어(inshore hagfish, 학명 Eptatretus burgeri)는 지역의 어부로부터 구매하였으며, 14~15℃의 수족관에 보관하였다. 먹장어를 0.1g/ℓ 에틸 3-아미노벤조에이트 메타네술포닉 애시드(ethyl 3-aminobenzoate methanesulfonic acid)에 침지시켜 마취시킨 후, 전혈을 수집하고 동량의 10mM EDTA(ethylenediaminetetraacetic acid)가 들어있는 0.67x PBS에 희석하였다. 500 x g, 10분 동안 원심분리하여 혈장을 획득하였다. 단백질 정량은 Pierce BCA 단백질 정량 키트(Thermo Scientific, 미국)를 이용하여 수행하였다. HEK(Human embryonic kidney) 293-F 세포는 Gibco(미국)사에서 구매하였고, 10% FBS(fetal bovine serum)가 포함된 DMEM(Dulbecco’s Modified Eagle’s Media) 배지를 사용하여 37℃에서 배양하였다.
[56]
[57]
2. 웨스턴 블롯팅
[58]
먹장어 혈장 시료(3.5㎍/레인)는 비환원 조건하의 8% native-PAGE 또는 12% SDS-PAGE에서 분리하고, PVDF 멤브레인으로 단백질을 트랜스퍼한 후, 먹장어 VLRB의 불변 stalk 부위를 인식하는 마우스 항-VLRB 항체(11G5)와 반응시켜 먹장어 VLRB 단백질을 확인하였다. 복합체의 VLRB의 계면활성제에 의한 파괴를 확인하기 위해, 먹장어 혈장 시료를 0, 0.003, 0.01, 0.03, 0.1 및 0.3%(v/v) 농도의 SDS(Sodium Dodecyl Sulfate)를 처리하고 상온에서 10분 동안 반응시킨 후, 전술한 방법으로 웨스턴 블롯을 수행하였다.
[59]
[60]
3. 크기 배제 크로마토그래피 및 면역블롯팅
[61]
600㎕ PBS에 희석시킨 먹장어 혈장 시료 100㎍을 0.2㎛ 멤브레인으로 여과하고, Superdex 200 10/300 GL(GE Healthcare, 영국)에 주입하고 크로마토그래피를 수행하였다. 먹장어 혈장으로부터 VLRB가 포함되어 있는 분획물을 확인하기 위해, 매 분마다 용출되는 각 분획물을 이용하여 닷 블롯팅(dot blotting)을 수행하였다. 용출된 분획물들이 닷 블롯팅에서 약한 신호를 보여주었기 때문에, 상기 분획물들을 동결건조를 통해 10배 농축하고, 농축된 시료를 이용하여 닷 블롯팅을 재수행하였고, 신호가 강하게 확인된 용출 분획물 시료를 선택하여 웨스턴 블롯을 실시하였다.
[62]
[63]
4. 투과 전자 현미경 관찰(transmission electron microscopy)
[64]
분획된 먹장어 VLRBs(16~17분 용출) 시료를 PBS를 이용하여 100배 희석시키고 최종 농도 50nM로 준비하였다. 상기 시료의 5㎕를 탄소 코팅된 그리드에 올리고 공기 중에서 3분 동안 글로 방전(glow-discharged)시켰다. 그 후, 그리드를 즉시 1% 아세트산우라닐(uranyl acetate)을 사용하여 negatively 염색하였다. 면역-금 표지 전자 현미경 분석을 위해, 50nM의 분획된 먹장어 VLRBs 시료를 마우스 항-VLRB 항체(11G5)와 1:2의 비율로 혼합하고 1시간 동안 반응시킨 후, 금 나노입자가 결합된 이차 항체를 처리하였다. 얼음 위해서 밤새 반응시킨 후, 상기와 같은 방법으로 negatively 염색하였다. 준비된 시료들은 Tecnai T10 transmission electron microscope(FEI, 미국)을 사용하여 관찰하였다.
[65]
[66]
5. 플라스미드 구축
[67]
포유류 발현 벡터 pTracer-EF/V5-His(Invitrogen Life Technologies, 미국)를 뮤린(murine) Ig κ사슬 리더 서열 및 두 개의 SfiⅠ 자리를 도입하기 위해 일부 변형하였다. 최종적으로 뮤린 Ig κ사슬 리더 서열, 두 개의 SfiⅠ 자리 및 클로람페니콜 저항성 유전자인 ccdB 유전자가 도입된 pKINGeo/ccdB를 제작하였다. 먹장어 VLRB 단백질의 소수성 카복시 말단 부위의 특징을 분석하기 위해, 상기 pKINGeo/ccdB 벡터에 리포터 유전자와 먹장어 VLRB의 소수성 카복시 말단 부위의 연속적 결실(serial deletion) 변이체를 제작하여 클로닝하였다.
[68]
[69]
6. 유세포 분석(flow cytometry ) 및 공초점현미경 관찰
[70]
HEK 293-F 세포를 6 웰 플레이트에 90% 정도 차게 배양한 후, 각 플라스미드를 제조사의 매뉴얼에 따라 lipofectamine 2000(Invitrogen, 미국)과 혼합한 후, 세포에 처리하였다. 4시간 후, 세포 배양액을 교체하고, 48시간 더 배양하였다. 그 후, 형질도입된 세포들을 수거하고, 마우스 항-VLRB 항체(11G5)와 반응시킨 후, FACSCalibur™ (BD Biosciences, 미국)을 사용하여 세포 분석을 수행하였다.
[71]
또한, HEK 293-F 세포를 8-챔버 슬라이드 위에 70% 정도 차게 배양한 후, 상기와 같이 플라스미드를 형질주입하였다. 형질도입된 세포들은 4% 파라포름알데히드로 고정하고, 30분 동안 0.1% BSA(bovine serum albumin)이 들어있는 PBS로 블롯킹한 후, 마우스 항-VLRB 항체(11G5)와 반응시킨 후, FITC-결합된 항-마우스 IgG 항체를 30분 반응시켰다. 최종 슬라이드는 Zeiss Axiovert 공초점현미경(Zeiss, 독일)을 사용하여 세포 이미지를 관찰하였다.
[72]
[73]
7. 포스포리파제 C( phospholipase C) 효소 처리
[74]
RFP-stalk 또는 RFP-stalk-HC를 발현하는 플라스미드를 HEK 293-F 세포에 형질도입하고 2일 뒤, 박테리아 GPI(glycosylphosphatidylinositol)-특이적 포스포리파제 C를 1 unit/ml, 3 unit/ml의 농도로 처리하고 30℃에서 45분 동안 반응시킨 후, 세포를 수확하였다. 포스포리파제 C를 처리한 세포를 항-VLRB 항체(11G5)와 반응시킨 후, 2차 항체로 FITC-결합된 항-마우스 IgG 항체를 처리하고, 유세포 분석을 실시하였다.
[75]
[76]
실시예 1. 먹장어 혈장 내 VLRB 다량체 복합체로 존재함을 확인
[77]
먹장어(hagfish)와 칠성장어(lamprey)의 VLRB 단백질 구조는 도 1과 같이 시그널 펩타이드(signal peptide, SP), LRRNT(N-terminal capped LRR), LRR1, LRRVs(variable LRR modules), CP(connecting peptide), LRRCT(C-terminal capped LRR), stalk, 그리고 카복시 말단(C-말단)으로 구성되어져 있으며 U자 모양의 3차 구조가 아주 유사하였다. 칠성장어의 C-말단은 시스테인(Cys) 잔기가 8개 존재하여 이미 보고된 바와 같이 8∼10개의 모노머(monomer)가 합쳐져 400 kDa 정도의 VLRB 복합체로 형성되어져 세포 표면에 발현되고, 또한 혈장 속으로 분비된다. 하지만, 먹장어 VLRB의 C-말단은 소수성(hydrophobicity)이 높은 아미노산들로 구성되어져 있음을 확인하였다(도 1).
[78]
먹장어 혈액 내 VLRB의 자연적 형태를 확인하기 위하여 추출한 혈장 단백질을 native-PAGE 또는 SDS-PAGE에서 분리한 후, 이전의 연구에서 개발한 먹장어 VLRB의 stalk 도메인을 검출할 수 있는 마우스 항-VLRB 항체(11G5)를 이용하여 웨스턴 블롯을 수행하였다. 먹장어 혈장 단백질들을 native-PAGE로 분리하였을 때 스태킹 겔(stacking gel)에 VLRB 단백질이 모두 존재하는 것을 확인하였다. 반면 다양한 SDS를 처리한 먹장어 혈장에서는 각각의 VLRB 단백질들이 모노머 형태로 분리되어 약 40 kDa의 분자량 크기로 분리되었다(도 2A 및 2B). 상기의 결과를 통해, 먹장어 VLRB 단백질은 자연적인 상태에서는 소수성 결합(hydrophobic interaction)에 의해 다량체를 형성하고 있으며, 상기 소수성 결합을 제거할 수 있는 계면활성제를 처리하였을 때 모노머 형태로 분리된다는 사실을 확인할 수 있었다.
[79]
혈장 단백질들을 분자 크기별로 분리하기 위해 사이즈 배제 크로마토그래피(size exclusion chromatography)를 수행하였고, 용출 시간에 따라 획득한 용출 분획물(1~48분, 0.5ml/분)을 시료로 하여 먹장어 VLRB 특이 항체(11G5)를 이용한 닷 블롯팅 수행 결과, 용출 후 15~23분에서 획득한 분획물에서 VLRB 단백질이 확인되었다(도 2C). 또한 획득된 각 분획물을 native-PAGE와 SDS-PAGE에서 11G5 항체를 이용하여 확인한 결과, 먹장어 VLRB 단백질이 확인되었다(도 2D). 특히 용출 후, 16~20분 사이에서 VLRB 단백질들이 가장 많이 확인되었으며, 이를 Ferguson plot으로 용출 VLRB 단백질들의 분자량을 유추해 보았을 때, 대략 600~1,700 kDa의 거대한 단백질 복합체의 형태로 먹장어 VLRB 단백질이 존재한다는 사실을 알 수 있었다(도 3). 이를 약 40 kDa에 상응하는 VLRB 모노머에 대비하여 계산해 보았을 때 VLRB 복합체는 약 16~42개 정도의 VLRB 모노머 단백질들이 C-말단의 소수성 부위로 인해 클로스터링(clustering)되어 다량체의 형태로 존재한다는 사실을 유추할 수 있다.
[80]
상기 사이즈 배제 크로마토그래피로 분리된 VLRB 단백질 복합체의 실제 이미지를 투과 전자 현미경(TEM)으로 조사하였다. FPLC(Fast protein liquid chromatography)를 통해 사이즈로 분리된 VLRB 분획물 중 메이저 집단(major population)으로 분리된 16분, 17분 분획물들을 Negatively stained TEM으로 실제 VLRB 이미지를 분석한 결과, 22~25 nm 크기의 구 형태 단백질 덩어리로 존재함이 관찰되었다(도 4). 특히 구형 입자의 중심 코어가 흰색으로 나타나는 것은 소수성 클로스터링이 내부에 위치함을 의미하였다. 또한 먹장어 VLRB 특이 항체인 11G5를 이용하고 금 표지된 2차 항체를 이용하여 VLRB를 검출하여 상기 결과를 검증하였다(도 4).
[81]
[82]
실시예 2. 먹장어 VLRB 카복시 말단을 포함하는 형광단백질의 다량체 형성 및 세포 표면 발현 확인
[83]
먹장어 VLRB 단백질의 소수성 카복시 말단(서열번호 1)이 다량체를 이루기 위한 실제 요소인지 확인하기 위해, VLRB 단백질의 stalk 부위부터 카복시 말단까지의 염기서열을 RFP(red fluorescent protein) 유전자에 연결하여 클로닝하였다. 또한 먹장어 VLRB 단백질의 소수성 말단(HC)의 연속적 결실(serial deletion) 변이체들(표 1)을 제작하여 HEK 293-F 세포주에서 발현시켰다. RFP-stalk 및 RFP-stalk-HC5 단백질들은 모두 모노머 형태로 관찰되었으나, VLRB 단백질의 소수성 말단(HC)이 늘어날수록 모노머 형태의 단백질 함유량은 감소하면서 다량체(multimer) 생성량은 증가하는 것이 관찰되었다(도 5). RFP-stalk-HC8 단백질에서 처음으로 다량체가 생성되었으며, RFP-stalk-HC15에서부터는 완전한 다량체만이 생성되었다.
[84]
[표1] RFP-stalk 및 RFP-stalk-HC 융합단백질
명칭 신호펩타이드 리포터단백질 Stalk 먹장어 소수성 말단(HC)
RFP-stalk Igκ RFP Stalk -
RFP-stalk-HC5 YFPSY
RFP-stalk-HC6 YFPSYI
RFP-stalk-HC7 YFPSYIF
RFP-stalk-HC8 YFPSYIFL
RFP-stalk-HC9 YFPSYIFLH
RFP-stalk-HC10 YFPSYIFLHL
RFP-stalk-HC15 YFPSYIFLHLVHGLA
RFP-stalk-HC20 YFPSYIFLHLVHGLAAVPLV
RFP-stalk-HC25 YFPSYIFLHLVHGLAAVPLVYLICH
RFP-stalk-HC YFPSYIFLHLVHGLAAVPLVYLICHASQLL

[85]
[86]
세포 표면에 융합 단백질이 실제로 발현되는지 관찰하기 위해 VLRB 단백질의 stalk 부위를 인식하는 특이 항체를 이용하여 유세포 분석을 수행하였다. 그 결과, 음성대조군 대비 많은 수의 세포에서, 표면에 디스플레이(display)된 VLRB 단백질을 확인할 수 있었다. 더욱이, 소수성 말단(HC) 부위를 함유한 RFP-stalk-HC가 형질도입된 HEK 293-F 세포에서만 세포 표면에 단백질이 존재하는 것이 확인되었다(도 6).
[87]
RFP-stalk 유전자에 HC를 연결시켜 제작한 RFP-stalk-HC는 HEK 293-F 세포주에서 발현되고 세포 외부로 중합체 형태로 분비될 뿐만 아니라, 세포 외막 바깥쪽에 디스플레이(display)되는 형태가 GPI(glycosylphosphatidylinositol)에 의해 연결되어 있음을 밝혔다. RFP-stalk, RFP-stalk-HC를 293-F 세포주에서 발현시킨 후 PLC(phospholipase C) 효소를 1 unit/ml, 3 unit/ml 농도별로 처리하였을 때, 세포막 외부에 존재하지 않는 RFP-stalk은 아무런 영향을 받지 않았으나, 세포막 외부에 GPI로 연결된 RFP-stalk-HC 단백질은 PLC에 의해 그 결합이 가수분해되는 것을 유세포 분석을 통해 확인하였다(도 7).
[88]
또한 먹장어의 소수성 말단 부위 전체가 연결된 RFP 단백질(RFP-stalk-HC)이 세포외부로 분비될 뿐만 아니라 포유류의 IgG, IgM 처럼 분비되기 전 세포 표면에 디스플레이되는지 확인하기 위해 공초점 현미경(confocal microscopy)으로 관찰하였다. 형질도입(transfection) 여부를 확인하기 위해 발현 벡터 시스템은 RFP 이외에 GFP 단백질 발현 부위를 함유하였다. RFP-stalk-HC로 형질도입된 293-F 세포에서만 세포 표면에 단백질들이 축적된다는 사실을 관찰하였다(도 8).
[89]
이상의 결과를 통해, 먹장어 VLRB 단백질은 발현 후 구 모양(globular-shaped)의 복합체 형태로 세포 외부, 즉 혈액으로 분비되며, 이는 칠성장어의 펜타머(pentamer) 구조와는 완전히 다른 형태로 분비된다는 사실이 확인되었다(도 9). 즉, 먹장어 VLRB 단백질은 포유류나 다른 종에서 전혀 발견되지 않은 특이한 형태의 항체구조를 가지고 있음을 보여준 것이다.

청구범위

[청구항 1]
먹장어 유래 VLRB(variable lymphocyte receptor B) 단백질의 소수성 테일 도메인 및 목적 단백질을 포함하며, 단량체의 자가조립에 의해 구형의 다량체 나노입자를 형성하는 것을 특징으로 하는 다가 중합체.
[청구항 2]
제1항에 있어서, 상기 먹장어 유래 VLRB 단백질의 소수성 테일 도메인은 서열번호 1의 아미노산 서열로 이루어진 것을 특징으로 하는 다가 중합체.
[청구항 3]
제1항에 있어서, 상기 목적 단백질은 VLR(variable lymphocyte receptor), 항원, 항체, 세포수용체 또는 효소인 것을 특징으로 하는 다가 중합체.
[청구항 4]
제1항에 있어서, 상기 구형의 나노입자는 내부에 먹장어 유래 VLRB 단백질의 소수성 테일 도메인이 위치하고 목적 단백질이 외부로 돌출되는 구조를 갖는 것을 특징으로 하는 다가 중합체.
[청구항 5]
제1항에 있어서, 상기 먹장어 유래 VLRB 단백질의 소수성 테일 도메인은 목적 단백질의 C-말단에 융합된 것을 특징으로 하는 다가 중합체.
[청구항 6]
제1항 내지 제5항 중 어느 한 항의 다가 중합체를 코딩하는 핵산.
[청구항 7]
제6항의 핵산을 포함하는 재조합 발현 벡터.
[청구항 8]
제7항의 재조합 발현 벡터로 형질전환된 숙주 세포.
[청구항 9]
1) 제1항의 다가 중합체를 코딩하는 핵산을 포함하는 재조합 발현 벡터를 제작하는 단계; 2) 상기 재조합 발현 벡터로 형질전환된 숙주 세포를 배양하는 단계; 및 3) 상기 배양한 숙주 세포로부터 구형의 나노입자를 형성하는 다가 중합체를 수득하는 단계를 포함하는, 구형의 나노입자를 형성하는 다가 중합체의 제조방법.
[청구항 10]
1) 제1항의 다가 중합체를 코딩하는 핵산을 포함하는 재조합 발현 벡터를 제작하는 단계; 2) 상기 재조합 발현 벡터로 형질전환된 숙주 세포를 배양하는 단계; 및 3) 상기 배양한 숙주 세포로부터 상기 다가 중합체를 세포 표면에 발현시키는 단계를 포함하는, 다가 중합체를 세포 표면에 발현시키는 방법.
[청구항 11]
먹장어 유래 VLRB(variable lymphocyte receptor B) 단백질의 소수성 테일 도메인을 유효성분으로 함유하는 다가 중합체의 구형의 나노입자 제조용 조성물.

도면

[도1]

[도2]

[도3]

[도4]

[도5]

[도6]

[도7]

[도8]

[도9]