Certains contenus de cette application ne sont pas disponibles pour le moment.
Si cette situation persiste, veuillez nous contacter àObservations et contact
1. (WO2018065440) MÉTHODES ET COMPOSITIONS PHARMACEUTIQUES POUR LE TRAITEMENT DU CANCER DU REIN
Dernières données bibliographiques dont dispose le Bureau international    Formuler une observation

N° de publication : WO/2018/065440 N° de la demande internationale : PCT/EP2017/075134
Date de publication : 12.04.2018 Date de dépôt international : 04.10.2017
CIB :
A61P 35/00 (2006.01) ,A61K 38/16 (2006.01)
A NÉCESSITÉS COURANTES DE LA VIE
61
SCIENCES MÉDICALE OU VÉTÉRINAIRE; HYGIÈNE
P
ACTIVITÉ THÉRAPEUTIQUE SPÉCIFIQUE DE COMPOSÉS CHIMIQUES OU DE PRÉPARATIONS MÉDICINALES
35
Agents anticancéreux
A NÉCESSITÉS COURANTES DE LA VIE
61
SCIENCES MÉDICALE OU VÉTÉRINAIRE; HYGIÈNE
K
PRÉPARATIONS À USAGE MÉDICAL, DENTAIRE OU POUR LA TOILETTE
38
Préparations médicinales contenant des peptides
16
Peptides ayant plus de 20 amino-acides; Gastrines; Somatostatines; Mélanotropines; Leurs dérivés
Déposants :
INSERM (INSTITUT NATIONAL DE LA SANTÉ ET DE LA RECHERCHE MÉDICALE) [FR/FR]; 101, rue de Tolbiac 75013 Paris, FR
UNIVERSITÉ DE BORDEAUX [FR/FR]; 35 Place Pey Berland 33000 Bordeaux, FR
INSTITUT BERGONIÉ [FR/FR]; 229 cours de l'Argonne 33000 Bordeaux, FR
Inventeurs :
SIEGFRIED, Géraldine; FR
KHATIB, Abdel-Majid; FR
HOEPFFNER, Jean-Luc; FR
EVRARD, Serge; FR
Données relatives à la priorité :
16306312.605.10.2016EP
17305507.004.05.2017EP
Titre (EN) METHODS AND PHARMACEUTICAL COMPOSITIONS FOR THE TREATMENT OF KIDNEY CANCER
(FR) MÉTHODES ET COMPOSITIONS PHARMACEUTIQUES POUR LE TRAITEMENT DU CANCER DU REIN
Abrégé :
(EN) The present invention relates to methods and pharmaceutical compositions for the treatment of kidney cancer. The inventors showed that while Elabela (ELA) is mostly expressed in kidney, its expression is reduced in human kidney cancer. In a xenograft animal model (sub-cutaneous, or sub-capsular injection) Ela inhibits tumor progression. In particular, the present invention relates to a method of treating kidney cancer in a subject in need thereof comprising administering to the subject a therapeutically effective amount of an ELA polypeptide comprising an amino acid sequence having at least 90% of identity with SEQ ID NO: 1 (QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP) wherein the arginine residue (R) at position 9, 10, 20 or 21 is optionally mutated.
(FR) La présente invention concerne des méthodes et des compositions pharmaceutiques pour le traitement du cancer du rein. Les inventeurs ont montré que si Elabela (ELA) est principalement exprimé dans le rein, son expression est réduite dans le cancer du rein humain. Dans un modèle animal de xénogreffe (injection sous-cutanée ou sous-capsulaire), ELA inhibe la progression tumorale. En particulier, la présente invention concerne une méthode de traitement du cancer du rein chez un sujet en ayant besoin, comprenant l'administration au sujet une quantité thérapeutiquement efficace d'un polypeptide ELA comprenant une séquence d'acides aminés ayant au moins 90% d'identité avec SEQ ID NO: 1 (QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP) où le résidu arginine (R) en position 9, 10, 20 ou 21 étant éventuellement muté.
États désignés : AE, AG, AL, AM, AO, AT, AU, AZ, BA, BB, BG, BH, BN, BR, BW, BY, BZ, CA, CH, CL, CN, CO, CR, CU, CZ, DE, DJ, DK, DM, DO, DZ, EC, EE, EG, ES, FI, GB, GD, GE, GH, GM, GT, HN, HR, HU, ID, IL, IN, IR, IS, JO, JP, KE, KG, KH, KN, KP, KR, KW, KZ, LA, LC, LK, LR, LS, LU, LY, MA, MD, ME, MG, MK, MN, MW, MX, MY, MZ, NA, NG, NI, NO, NZ, OM, PA, PE, PG, PH, PL, PT, QA, RO, RS, RU, RW, SA, SC, SD, SE, SG, SK, SL, SM, ST, SV, SY, TH, TJ, TM, TN, TR, TT, TZ, UA, UG, US, UZ, VC, VN, ZA, ZM, ZW
Organisation régionale africaine de la propriété intellectuelle (ARIPO) (BW, GH, GM, KE, LR, LS, MW, MZ, NA, RW, SD, SL, ST, SZ, TZ, UG, ZM, ZW)
Office eurasien des brevets (OEAB) (AM, AZ, BY, KG, KZ, RU, TJ, TM)
Office européen des brevets (OEB (AL, AT, BE, BG, CH, CY, CZ, DE, DK, EE, ES, FI, FR, GB, GR, HR, HU, IE, IS, IT, LT, LU, LV, MC, MK, MT, NL, NO, PL, PT, RO, RS, SE, SI, SK, SM, TR)
Organisation africaine de la propriété intellectuelle (OAPI) (BF, BJ, CF, CG, CI, CM, GA, GN, GQ, GW, KM, ML, MR, NE, SN, TD, TG)
Langue de publication : anglais (EN)
Langue de dépôt : anglais (EN)