WIPO logo
Mobile | Deutsch | English | Español | 日本語 | 한국어 | Português | Русский | 中文 | العربية |
PATENTSCOPE

Recherche dans les collections de brevets nationales et internationales
World Intellectual Property Organization
Recherche
 
Options de navigation
 
Traduction
 
Options
 
Quoi de neuf
 
Connexion
 
Aide
 
Traduction automatique
1. (WO2015111013) SYNTHETASES DE LA COLISTINE ET CLUSTER DE GENES CORRESPONDANTS
Dernières données bibliographiques dont dispose le Bureau international   

N° de publication :    WO/2015/111013    N° de la demande internationale :    PCT/IB2015/050571
Date de publication : 30.07.2015 Date de dépôt international : 26.01.2015
CIB :
C12N 9/00 (2006.01)
Déposants : CENTRE NATIONAL DE LA RECHERCHE SCIENTIFIQUE [FR/FR]; 3 rue Michel Ange F-75794 Paris Cedex 16 (FR).
UNIVERSITE LA ROCHELLE [FR/FR]; 23 avenue Albert Einstein F-17000 La Rochelle (FR)
Inventeurs : CHEVROT, Romain; (FR).
TAMBADOU, Fatoumata; (FR).
CARADEC, Thibault; (FR).
DIDELOT, Sandrine; (FR).
BARTHELEMY, Cyrille; (FR)
Mandataire : JUPIN, Claude; (FR)
Données relatives à la priorité :
1450641 27.01.2014 FR
Titre (EN) COLISTIN SYNTHETASES AND CORRESPONDING GENE CLUSTER
(FR) SYNTHETASES DE LA COLISTINE ET CLUSTER DE GENES CORRESPONDANTS
Abrégé : front page image
(EN)Synthetase PmxA involved in the synthesis of polymyxin E, comprising four adenylation sites, characterised in that the second adenylation site has at least 90% identity with the peptide sequence SEQ ID NO 1: VTEAEKADLLGRFNDTTTEFPRGKTLIQLFEEQVERIPDAAAITLNEQE LTYRELNERVNRLARTLRSHGISKGRLVAILAERSIEMVVGMLAAHKAGAAYVPI DPEYPEERIRFLIEDSGGQVMLTQSRLRERLAGSDPVILLDDESFYHEDGTNLNTGI EATDLACVIYTSGTTGKPKGNPVSHRNIVRVVQNTNYIDITERDHVLQLSSYSFDG ATFDIFGALTNGARLVLVPYETLLEIGRLADLIQRERISVMFITTAFFNILVDVNVD CLRDVRAILFGGERVSVGHVRKALAHIGPGRLNHVYGPTESTVYTTYLPVDFVDE LAVTVPIGRPISNTTVYIVDSRNKLLPIGVAGELCVGGEGLVRGYNNRPELTAEKF VDNPFVPGERMYRTGDLAKWLPDGTIEYVGRTDDQVKIRGFRIELGEIEAQLQKV EGIRKTTVFARENASGEKQLCAYYEADCELPAAELKSVLSKELPAYMIPAYLIQLE RLPLTTNGKVDRRSLPAPEESLQPGGG, underlined amino acids DGFFLGVVYK being conserved and forming a specific binding pocket for a leucine, isoleucine or valine residue.
(FR)Synthétase PmxA impliquée dans la synthèse de polymyxine E, comprenant quatre sites d'adénylation, caractérisée en ce que le second site d'adénylation présente au moins 90% d'identité avec la séquence peptidique SEQ ID NO 1: VTEAEKADLLGRFNDTTTEFPRGKTLIQLFEEQVERIPDAAAITLNEQE LTYRELNERVNRLARTLRSHGISKGRLVAILAERSIEMVVGMLAAHKAGAAYVPI DPEYPEERIRFLIEDSGGQVMLTQSRLRERLAGSDPVILLDDESFYHEDGTNLNTGI EATDLACVIYTSGTTGKPKGNPVSHRNIVRVVQNTNYIDITERDHVLQLSSYSFDG ATFDIFGALTNGARLVLVPYETLLEIGRLADLIQRERISVMFITTAFFNILVDVNVD CLRDVRAILFGGERVSVGHVRKALAHIGPGRLNHVYGPTESTVYTTYLPVDFVDE LAVTVPIGRPISNTTVYIVDSRNKLLPIGVAGELCVGGEGLVRGYNNRPELTAEKF VDNPFVPGERMYRTGDLAKWLPDGTIEYVGRTDDQVKIRGFRIELGEIEAQLQKV EGIRKTTVFARENASGEKQLCAYYEADCELPAAELKSVLSKELPAYMIPAYLIQLE RLPLTTNGKVDRRSLPAPEESLQPGGG, les acides aminés soulignés DGFFLGVVYK étant conservés et formant une poche de liaison spécifique pour un résidu leucine, isoleucine ou valine.
États désignés : AE, AG, AL, AM, AO, AT, AU, AZ, BA, BB, BG, BH, BN, BR, BW, BY, BZ, CA, CH, CL, CN, CO, CR, CU, CZ, DE, DK, DM, DO, DZ, EC, EE, EG, ES, FI, GB, GD, GE, GH, GM, GT, HN, HR, HU, ID, IL, IN, IR, IS, JP, KE, KG, KN, KP, KR, KZ, LA, LC, LK, LR, LS, LU, LY, MA, MD, ME, MG, MK, MN, MW, MX, MY, MZ, NA, NG, NI, NO, NZ, OM, PA, PE, PG, PH, PL, PT, QA, RO, RS, RU, RW, SA, SC, SD, SE, SG, SK, SL, SM, ST, SV, SY, TH, TJ, TM, TN, TR, TT, TZ, UA, UG, US, UZ, VC, VN, ZA, ZM, ZW.
Organisation régionale africaine de la propriété intellectuelle (ARIPO) (BW, GH, GM, KE, LR, LS, MW, MZ, NA, RW, SD, SL, ST, SZ, TZ, UG, ZM, ZW)
Office eurasien des brevets (OEAB) (AM, AZ, BY, KG, KZ, RU, TJ, TM)
Office européen des brevets (OEB) (AL, AT, BE, BG, CH, CY, CZ, DE, DK, EE, ES, FI, FR, GB, GR, HR, HU, IE, IS, IT, LT, LU, LV, MC, MK, MT, NL, NO, PL, PT, RO, RS, SE, SI, SK, SM, TR)
Organisation africaine de la propriété intellectuelle (OAPI) (BF, BJ, CF, CG, CI, CM, GA, GN, GQ, GW, KM, ML, MR, NE, SN, TD, TG).
Langue de publication : français (FR)
Langue de dépôt : français (FR)