WIPO logo
Mobile | Deutsch | English | Español | 日本語 | 한국어 | Português | Русский | 中文 | العربية |
PATENTSCOPE

Recherche dans les collections de brevets nationales et internationales
World Intellectual Property Organization
Recherche
 
Options de navigation
 
Traduction
 
Options
 
Quoi de neuf
 
Connexion
 
Aide
 
Traduction automatique
1. (WO2007144198) INHIBITEURS DU FPLR-1 (FLIPr ET TYPE FLIPr) À UTILISER DANS DES MALADIES IMPLIQUANT DES ÉPISODES INFLAMMATOIRES INDUITS PAR LES AMYLOÏDES ET DES MALADIES MÉDIÉES PAR LE COMPLEXE IMMUNITAIRE
Dernières données bibliographiques dont dispose le Bureau international   

N° de publication :    WO/2007/144198    N° de la demande internationale :    PCT/EP2007/005340
Date de publication : 21.12.2007 Date de dépôt international : 18.06.2007
CIB :
C07K 14/31 (2006.01)
Déposants : UMC UTRECHT HOLDING B.V. [NL/NL]; Yalelaan 40, NL-3584 CM Utrecht (NL) (Tous Sauf US).
VAN KESSEL, Cornelis, Petrus, Maria [NL/NL]; (NL) (US Seulement).
VAN STRIJP, Johannes, Antonius, Gerardus [NL/NL]; (NL) (US Seulement)
Inventeurs : VAN KESSEL, Cornelis, Petrus, Maria; (NL).
VAN STRIJP, Johannes, Antonius, Gerardus; (NL)
Mandataire : VAN SOMEREN, Petronella, Francisca, Hendrika, Maria; Arnold & Siedsma, Sweelinckplein 1, NL-2517 GK The Hague (NL)
Données relatives à la priorité :
06012380.9 16.06.2006 EP
Titre (EN) FPLR-1 INHIBITORS FOR USE IN DISEASES INVOLVING AMYLOID-INDUCED INFLAMMATORY EVENTS (FLIPR AND FLIPR-LIKE) AND IMMUNECOMPLEX-MEDIATED DISEASES
(FR) INHIBITEURS DU FPLR-1 (FLIPr ET TYPE FLIPr) À UTILISER DANS DES MALADIES IMPLIQUANT DES ÉPISODES INFLAMMATOIRES INDUITS PAR LES AMYLOÏDES ET DES MALADIES MÉDIÉES PAR LE COMPLEXE IMMUNITAIRE
Abrégé : front page image
(EN)The present invention relates to a FPLR-1 inhibitor selected from the group consisting of FLIPr having the amino acid sequence MKKNITKTIIASTVIAAGLLTQTNDAKAFFSYEWKGLEIAKNLADQAKKDDERIDKLMKESDKNLTPYKAETVNDLYLIVKKLSQGDVKKAVVRIKDGGPRDYYTFDLTRPLEENRKNIKVVKNGEIDSIYWD; FLIPr-like having the amino acid sequence MKKNITKTIIASTVIAAGLLTQTNDAKAFFSYEWKGLEIAKNLADQAKKDDERADKLIKEADEKNEHYKGKTVEDLYVIAKKMGKGNTIAVVKIKDGGKNGYYTFDITRPLEEHRKNIPVVKNGEIDSITWY; fragments of a) or b) having FPLR-1 inhibitory activity; homologues of a), b) or c) having FPLR-1 inhibitory activity; or derivatives of a), b), c) or d) having FPLR-1 inhibitory activity.
(FR)La présente invention concerne un inhibiteur de FPLR-1 choisi dans le groupe constitué par la protéine FLIPr présentant la séquence d'acides aminés MKKNITKTIIASTVIAAGLLTQTNDAKAFFSYEWKGLEIAKNLADQAKKDDERIDKLMKESDKNLTPYKAETVNDLYLIVKKLSQGDVKKAVVRIKDGGPRDYYTFDLTRPLEENRKNIKVVKNGEIDSIYWD; la protéine de type FLIPr présentant la séquence d'acides aminés MKKNITKTIIASTVIAAGLLTQTNDAKAFFSYEWKGLEIAKNLADQAKKDDERADKLIKEADEKNEHYKGKTVEDLYVIAKKMGKGNTIAVVKIKDGGKNGYYTFDITRPLEEHRKNIPVVKNGEIDSITWY; des fragments de a) ou de b) dotés d'une activité inhibitrice de FPLR-1; des homologues de a), de b) ou de c) dotés d'une activité inhibitrice du FPLR-1; ou des dérivés de a), de b), de c) ou de d) dotés d'une activité inhibitrice de FPLR-1.
États désignés : AE, AG, AL, AM, AT, AU, AZ, BA, BB, BG, BH, BR, BW, BY, BZ, CA, CH, CN, CO, CR, CU, CZ, DE, DK, DM, DO, DZ, EC, EE, EG, ES, FI, GB, GD, GE, GH, GM, GT, HN, HR, HU, ID, IL, IN, IS, JP, KE, KG, KM, KN, KP, KR, KZ, LA, LC, LK, LR, LS, LT, LU, LY, MA, MD, MG, MK, MN, MW, MX, MY, MZ, NA, NG, NI, NO, NZ, OM, PG, PH, PL, PT, RO, RS, RU, SC, SD, SE, SG, SK, SL, SM, SV, SY, TJ, TM, TN, TR, TT, TZ, UA, UG, US, UZ, VC, VN, ZA, ZM, ZW.
Organisation régionale africaine de la propriété intellectuelle (ARIPO) (BW, GH, GM, KE, LS, MW, MZ, NA, SD, SL, SZ, TZ, UG, ZM, ZW)
Office eurasien des brevets (OEAB) (AM, AZ, BY, KG, KZ, MD, RU, TJ, TM)
Office européen des brevets (OEB) (AT, BE, BG, CH, CY, CZ, DE, DK, EE, ES, FI, FR, GB, GR, HU, IE, IS, IT, LT, LU, LV, MC, MT, NL, PL, PT, RO, SE, SI, SK, TR)
Organisation africaine de la propriété intellectuelle (OAPI) (BF, BJ, CF, CG, CI, CM, GA, GN, GQ, GW, ML, MR, NE, SN, TD, TG).
Langue de publication : anglais (EN)
Langue de dépôt : anglais (EN)