WIPO logo
Mobile | Deutsch | English | Español | 日本語 | 한국어 | Português | Русский | 中文 | العربية |
PATENTSCOPE

Recherche dans les collections de brevets nationales et internationales
World Intellectual Property Organization
Recherche
 
Options de navigation
 
Traduction
 
Options
 
Quoi de neuf
 
Connexion
 
Aide
 
Traduction automatique
1. (WO2006127020) EPITOPES FONCTIONNELS D'ANTIGENE PSAA DE STREPTOCOCCUS PNEUMONIAE ET LEURS UTILISATIONS
Dernières données bibliographiques dont dispose le Bureau international   

N° de publication :    WO/2006/127020    N° de la demande internationale :    PCT/US2005/027290
Date de publication : 30.11.2006 Date de dépôt international : 29.07.2005
CIB :
C07K 14/315 (2006.01), A61K 39/09 (2006.01), C07K 16/12 (2006.01)
Déposants : THE GOVERNMENT OF THE UNITED STATES OF AMERICA, as represented by THE SECRETARY, DEPARTMENT OF HEALTH AND HUMAN SERVICES, CENTERS FOR DISEASE CONTROL AND PREVENTION [US/US]; Office of Technology Transfer, 4770 Buford Highway, (K-79), Atlanta, GA 30341 (US) (Tous Sauf US).
ADES, Edwin, W. [US/US]; (US) (US Seulement).
SAMPSON, Jacquelyn, S. [US/US]; (US) (US Seulement).
STEINER, Sandra [US/US]; (US) (US Seulement).
CARLONE, George, M. [US/US]; (US) (US Seulement).
CABA, Joseph, J. [US/US]; (US) (US Seulement).
RAJAM, Gowrisankar [IN/US]; (US) (US Seulement)
Inventeurs : ADES, Edwin, W.; (US).
SAMPSON, Jacquelyn, S.; (US).
STEINER, Sandra; (US).
CARLONE, George, M.; (US).
CABA, Joseph, J.; (US).
RAJAM, Gowrisankar; (US)
Mandataire : SPRATT, Gwendolyn, D.; Needle & Rosenberg, P.C., Suite 1000, 999 Peachtree Street, Atlanta, Georgia 30309-3915 (US)
Données relatives à la priorité :
60/682,495 19.05.2005 US
Titre (EN) FUNCTIONAL EPITOPES OF STREPTOCOCCUS PNEUMONIAE PsaA ANTIGEN AND USES THEREOF
(FR) EPITOPES FONCTIONNELS D'ANTIGENE PSAA DE STREPTOCOCCUS PNEUMONIAE ET LEURS UTILISATIONS
Abrégé : front page image
(EN)Provided is a P4 peptide, which contains functional epitopes of the PsaA protein of Streptococcus pneumoniae, and related methods and compositions. A peptide that comprises the amino acid sequence defined in SEQ ID NO:1 (an example of the P4 peptide) is provided. Also provided is a peptide comprising the amino acid sequence defined as VPSLFVDSSVDDRPMKTVSQDTNIPIYAQIFTDS (SEQ ID NO:2). P4 peptide mimetics having a conformational structure identical or similar to the conformation of P4 (e.g., SEQ ID NO: 1 and SEQ ID NO:2) are provided. An antibody that specifically binds to the epitope defined by the disclosed peptides is provided. For example, the antibody can specifically bind to a peptide comprising the sequence set forth in SEQ ID NO: 1 and having the conformation defined by the peptide consisting of SEQ ID NO: 1. An antibody that specifically binds to a peptide comprising the sequence set forth in SEQ ID NO:2 and having the conformation defined by the peptide consisting of SEQ ID NO:2 is also provided. A P4-specific antibody is PsaA-specific since P4 defines an epitope specific for PsaA. A vaccine comprising the peptide of SEQ ID NO: 1 and a pharmaceutical carrier is provided. A vaccine comprising a peptide of SEQ ID NO:2 and a pharmaceutical carrier is also provided. Methods of using the peptides and antibodies of the invention are provided. Diagnostic kits comprising a P4 peptide is also provided.
(FR)La présente invention a trait à un peptide P4, qui contient des épitopes fonctionnels de la protéine PsaA de Streptococcus pneumoniae, et des procédés et compositions associés. L'invention a trait à un peptide qui comporte la séquence d'acides aminés définis dans SEQ ID NO: 1 (un exemple du peptide P4). L'invention a également trait à un peptide comportant la séquence d'acides aminés définie par VPSLFVDSSVDDRPMKTVSQDTNIPIYAQIFTDS (SEQ ID NO:2). L'invention a également trait à des mimétiques du peptide P4 ayant une structure conformationnelle identique ou semblable à la conformation de P4 (par exemple, SEQ ID NO: 1 et SEQ ID NO:2). L'invention a trait à un anticorps de liaison spécifique à l'épitope défini par les peptides de l'invention. Par exemple, l'anticorps peut se lier de manière spécifique à un peptide comportant la séquence définie dans SEQ ID NO: 1 et présentant la conformation définie par le peptide constitué de SEQ ID NO:1. L'invention a également trait à un anticorps de liaison spécifique à un peptide comportant la séquence définie par SEQ ID NO:2 et présentant la conformation définie par le peptide constitué de SEQ ID NO:2. L'invention a trait à un anticorps spécifique de P4 qui est spécifique de PsaA étant donné que P4 définit un épitope spécifique pour PsaA. L'invention a trait à un vaccin comportant le peptide de SEQ ID NO: 1 et un support pharmaceutique. L'invention a également trait à un vaccin comportant le peptide de SEQ ID NO: 2 et un support pharmaceutique. L'invention a trait en outre à des procédés d'utilisation des peptides et anticorps de l'invention. Enfin, l'invention a trait à des trousses de diagnostic comportant un peptide P4.
États désignés : AE, AG, AL, AM, AT, AU, AZ, BA, BB, BG, BR, BW, BY, BZ, CA, CH, CN, CO, CR, CU, CZ, DE, DK, DM, DZ, EC, EE, EG, ES, FI, GB, GD, GE, GH, GM, HR, HU, ID, IL, IN, IS, JP, KE, KG, KM, KP, KR, KZ, LC, LK, LR, LS, LT, LU, LV, MA, MD, MG, MK, MN, MW, MX, MZ, NA, NG, NI, NO, NZ, OM, PG, PH, PL, PT, RO, RU, SC, SD, SE, SG, SK, SL, SM, SY, TJ, TM, TN, TR, TT, TZ, UA, UG, US, UZ, VC, VN, YU, ZA, ZM, ZW.
Organisation régionale africaine de la propriété intellectuelle (ARIPO) (BW, GH, GM, KE, LS, MW, MZ, NA, SD, SL, SZ, TZ, UG, ZM, ZW)
Office eurasien des brevets (OEAB) (AM, AZ, BY, KG, KZ, MD, RU, TJ, TM)
Office européen des brevets (OEB) (AT, BE, BG, CH, CY, CZ, DE, DK, EE, ES, FI, FR, GB, GR, HU, IE, IS, IT, LT, LU, LV, MC, NL, PL, PT, RO, SE, SI, SK, TR)
Organisation africaine de la propriété intellectuelle (OAPI) (BF, BJ, CF, CG, CI, CM, GA, GN, GQ, GW, ML, MR, NE, SN, TD, TG).
Langue de publication : anglais (EN)
Langue de dépôt : anglais (EN)