Traitement en cours

Veuillez attendre...

Paramétrages

Paramétrages

Aller à Demande

1. WO2005019253 - PEPTIDES DERIVES DE PLANTES AUX PROPRIETES DE NETTOYAGE D'EAU ET ANTIMICROBIENNES

Numéro de publication WO/2005/019253
Date de publication 03.03.2005
N° de la demande internationale PCT/CH2004/000536
Date du dépôt international 23.08.2004
CIB
C07K 14/415 2006.01
CCHIMIE; MÉTALLURGIE
07CHIMIE ORGANIQUE
KPEPTIDES
14Peptides ayant plus de 20 amino-acides; Gastrines; Somatostatines; Mélanotropines; Leurs dérivés
415provenant de végétaux
CPC
A01N 37/46
AHUMAN NECESSITIES
01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
NPRESERVATION OF BODIES OF HUMANS OR ANIMALS OR PLANTS OR PARTS THEREOF; BIOCIDES, e.g. AS DISINFECTANTS, AS PESTICIDES, AS HERBICIDES
37Biocides, pest repellants or attractants, or plant growth regulators containing organic compounds containing a carbon atom having three bonds to hetero atoms with at the most two bonds to halogen, e.g. carboxylic acids
44containing at least one carboxylic group or a thio analogue, or a derivative thereof, and a nitrogen atom attached to the same carbon skeleton by a single or double bond, this nitrogen atom not being a member of a derivative or of a thio analogue of a carboxylic group, e.g. amino-carboxylic acids
46N-acyl derivatives
A01N 65/00
AHUMAN NECESSITIES
01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
NPRESERVATION OF BODIES OF HUMANS OR ANIMALS OR PLANTS OR PARTS THEREOF; BIOCIDES, e.g. AS DISINFECTANTS, AS PESTICIDES, AS HERBICIDES
65Biocides, pest repellants or attractants, or plant growth regulators containing material from algae, lichens, bryophyta, multi-cellular fungi or plants, or extracts thereof
A61K 38/00
AHUMAN NECESSITIES
61MEDICAL OR VETERINARY SCIENCE; HYGIENE
KPREPARATIONS FOR MEDICAL, DENTAL, OR TOILET PURPOSES
38Medicinal preparations containing peptides
C07K 14/415
CCHEMISTRY; METALLURGY
07ORGANIC CHEMISTRY
KPEPTIDES
14Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
415from plants
Déposants
  • OPTIMA ENVIRONNEMENT S.A. [CH]/[CH] (AllExceptUS)
  • MERMOD, Nicolas [CH]/[CH] (UsOnly)
  • SUAREZ, Mougli [UY]/[CH] (UsOnly)
Inventeurs
  • MERMOD, Nicolas
  • SUAREZ, Mougli
Mandataires
  • ROLAND, André
Données relatives à la priorité
PCT/CH03/0056822.08.2003CH
Langue de publication anglais (EN)
Langue de dépôt anglais (EN)
États désignés
Titre
(EN) PLANT-DERIVED PEPTIDES HARBORING WATER-CLEANING AND ANTIMICROBIAL ACTIVITIES
(FR) PEPTIDES DERIVES DE PLANTES AUX PROPRIETES DE NETTOYAGE D'EAU ET ANTIMICROBIENNES
Abrégé
(EN)
Protein family derived from the protein defined by the sequence QGPGRQPDFQRCGQQLRNISPPQRCPSLRQAVQLTHQQQGQVGPQQVRQMYRVASNIPST
(FR)
L'invention concerne une famille de protéines dérivée de la protéine définie par la séquence QGPGRQPDFQRCGQQLRNISPPQRCPSLRQAVQLTHQQQGQVGPQQVRQMYRVASNIPST
Également publié en tant que
US2007099838
Dernières données bibliographiques dont dispose le Bureau international