WIPO logo
Mobile | Deutsch | English | Español | 日本語 | 한국어 | Português | Русский | 中文 | العربية |
PATENTSCOPE

Recherche dans les collections de brevets nationales et internationales
World Intellectual Property Organization
Recherche
 
Options de navigation
 
Traduction
 
Options
 
Quoi de neuf
 
Connexion
 
Aide
 
Traduction automatique
1. (WO1998027200) SEQUENCES CONSENSUS DE L'ORIGINE DE REPLICATION D'ADN HUMAIN ET D'ADN DE MAMMIFERE
Dernières données bibliographiques dont dispose le Bureau international   

N° de publication :    WO/1998/027200    N° de la demande internationale :    PCT/CA1997/000972
Date de publication : 25.06.1998 Date de dépôt international : 12.12.1997
Demande présentée en vertu du Chapitre 2 :    10.07.1998    
CIB :
C12N 15/85 (2006.01)
Déposants : McGILL UNIVERSITY [CA/CA]; 845 Sherbrooke Street West, Montreal, Quebec H3A 1B1 (CA) (Tous Sauf US).
PRICE, Gerald, B. [CA/CA]; (CA) (US Seulement).
ZANNIS-HADJOPOULOS, Maria [CA/CA]; (CA) (US Seulement).
NIELSEN, Torsten, O. [CA/CA]; (CA) (US Seulement).
COSSONS, Nandini, H. [CA/CA]; (CA) (US Seulement)
Inventeurs : PRICE, Gerald, B.; (CA).
ZANNIS-HADJOPOULOS, Maria; (CA).
NIELSEN, Torsten, O.; (CA).
COSSONS, Nandini, H.; (CA)
Mandataire : COTE, France; Swabey Ogilvy Renault, Suite 1600, 1981 McGill College Avenue, Montreal, Quebec H3A 2Y3 (CA)
Données relatives à la priorité :
60/033,374 16.12.1996 US
60/047,322 21.05.1997 US
Titre (EN) HUMAN AND MAMMALIAN DNA REPLICATION ORIGIN CONSENSUS SEQUENCES
(FR) SEQUENCES CONSENSUS DE L'ORIGINE DE REPLICATION D'ADN HUMAIN ET D'ADN DE MAMMIFERE
Abrégé : front page image
(EN)The present invention relates to a human or mammalian DNA replication origin consensus sequence which consists of a sequence selected from the group consisting of CCTMDAWKSGBYTSMAAWYWBCMYTTRSCAAATTCC (SEQ ID NO:1); and AWMTWAAKRAWRWWKKDAVWWGAKRWWKWVWHRASSACMDWKAAKTWKGGWTWARRYWKGRKMWWTWKAWSDATAKWWWKDAKWKMWRKTT (SEQ ID NO:4). A method for the control of initiation of mammalian DNA replication which comprises the steps of: a) inserting a consensus sequence coding for a sequence of the present invention together with a DNA fragment to form a vector capable of expression of the DNA fragment; b) introducing the vector of step a) into mammalian cells $i(in vitro).
(FR)L'invention concerne une séquence consensus de l'origine de réplication d'ADN humain ou d'ADN de mammifère, qui est constituée d'une séquence choisie dans le groupe comprenant CCTMDAWKSGBYTSMAAWYWBCMYTTRSCAAATTCC (SEQ ID NO:1) et AWMTWAAKRAWRWWKKDAVWWGAKRWWKWVWHRASSACMDWKAAKTWKGGWTWARRYWKGRKMWWTWKAWSDATAKWWWKDAKWKMWRKTT (SEQ ID NO:4). Elle concerne également une méthode permettant de contrôler l'initiation de la réplication de l'ADN d'un mammifère, selon laquelle: a) on insère une séquence consensus codant pour une séquence de la présente invention en même temps qu'un fragment d'ADN, de façon à former un vecteur capable d'exprimer ledit fragment; et b) on introduit le vecteur de l'étape a) dans des cellules de mammifère $i(in vitro).
États désignés : AL, AM, AT, AU, AZ, BA, BB, BG, BR, BY, CA, CH, CN, CU, CZ, DE, DK, EE, ES, FI, GB, GE, GH, HU, ID, IL, IS, JP, KE, KG, KP, KR, KZ, LC, LK, LR, LS, LT, LU, LV, MD, MG, MK, MN, MW, MX, NO, NZ, PL, PT, RO, RU, SD, SE, SG, SI, SK, SL, TJ, TM, TR, TT, UA, UG, US, UZ, VN, YU, ZW.
Organisation régionale africaine de la propriété intellectuelle (ARIPO) (GH, GM, KE, LS, MW, SD, SZ, UG, ZW)
Office eurasien des brevets (OEAB) (AM, AZ, BY, KG, KZ, MD, RU, TJ, TM)
Office européen des brevets (OEB) (AT, BE, CH, DE, DK, ES, FI, FR, GB, GR, IE, IT, LU, MC, NL, PT, SE)
Organisation africaine de la propriété intellectuelle (OAPI) (BF, BJ, CF, CG, CI, CM, GA, GN, ML, MR, NE, SN, TD, TG).
Langue de publication : anglais (EN)
Langue de dépôt : anglais (EN)