WIPO logo
Mobile | Deutsch | English | Español | 日本語 | 한국어 | Português | Русский | 中文 | العربية |
PATENTSCOPE

Recherche dans les collections de brevets nationales et internationales
World Intellectual Property Organization
Recherche
 
Options de navigation
 
Traduction
 
Options
 
Quoi de neuf
 
Connexion
 
Aide
 
maximize
Traduction automatique
1. (WO1998027200) SEQUENCES CONSENSUS DE L'ORIGINE DE REPLICATION D'ADN HUMAIN ET D'ADN DE MAMMIFERE
Note: Texte fondé sur des processus automatiques de reconnaissance optique de caractères. Seule la version PDF a une valeur juridique

WHAT IS CLAIMED IS;

1. A human or mammalian DNA replication origin consensus sequence which consists of a sequence selected from the group consisting of:
CCTMDAWKSGBYTSMAAWYWBCMYTTRSCAAATTCC (SEQ ID N0:1), functional variants thereof having a sequence of at least 70% homology, functional fragments thereof of at least 20 nucleotides; AWMTWAAKRAWRWWKKDAVWWGAKRWW KWVWHRASSACMDWKAAKTWKGGWTWARRYWKGRKMWWTWKAWSDATAKWWWKDA KWKMWRKTT (SEQ ID NO : 4 ) , and functional variants thereof having a sequence of at least 70% homology.

2. A method for the control of initiation of mammalian DNA replication which comprises the steps of: a) inserting a consensus sequence according to claim 1 together with a DNA fragment to form a vector capable of expression of said DNA fragment;
b) introducing the vector of step a) into mammalian cells in vi tro.

3. The method of claim 2, wherein the vector may be selected from the group consisting of viral vectors.

4. The method of claim 2, wherein introducing the vector of step b) is effected by a standard method selected from the group consisting of calcium phosphate co-precipitation transfection, electroporation, micro-injection, liposome-mediated transfection, and virally transmitted DNA.

5. A DNA sequence for the maintenance of circular plasmid constructs which are capable of being replicated semiconservatively in proliferating mammalian cells, which comprises at least one consensus sequence consisting of a sequence according to claim 1.

6. A DNA sequence suitable for inclusion in mammalian and human artificial chromosome vectors or for gene therapy, which comprises at least one consensus sequence consisting of a sequence according to claim 1.

7. A protein which binds double-stranded DNA, which protein is isolated from HeLa cells and comprises about 150 kDa and two subunits of about 86 and 70 kDa in a glycerol gradient.

8. An anti-gene to DNA replication, which comprises a doubled-stranded form of a sequence according to claim 1.

9. A method of inhibiting DNA replication in vi tro or in vivo, which comprises administering a sequence according to claim 1 in single-stranded or double-stranded form.

10. The use of a sequence according to claim 1 for inhibiting DNA replication in vi tro or in vivo, wherein said sequence is in single-stranded or double-stranded form.