Processing

Please wait...

Settings

Settings

Goto Application

1. WO2022002982 - MANNOSE RECEPTOR-DERIVED PEPTIDES FOR NEUTRALIZING PORE-FORMING TOXINS FOR THERAPEUTIC USES

Publication Number WO/2022/002982
Publication Date 06.01.2022
International Application No. PCT/EP2021/067923
International Filing Date 29.06.2021
IPC
C07K 14/705 2006.1
CCHEMISTRY; METALLURGY
07ORGANIC CHEMISTRY
KPEPTIDES
14Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
435from animals; from humans
705Receptors; Cell surface antigens; Cell surface determinants
CPC
C07K 14/705
CCHEMISTRY; METALLURGY
07ORGANIC CHEMISTRY
KPEPTIDES
14Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
435from animals; from humans
705Receptors; Cell surface antigens; Cell surface determinants
Applicants
  • HENRIQUES NORMARK, Birgitta [SE]/[SE]
Inventors
  • HENRIQUES NORMARK, Birgitta
  • SUBRAMANIAM, Karthik
  • SOTIRIOU, Georgios
Agents
  • NOVITAS PATENT AB
Priority Data
2050805-730.06.2020SE
Publication Language English (en)
Filing Language English (EN)
Designated States
Title
(EN) MANNOSE RECEPTOR-DERIVED PEPTIDES FOR NEUTRALIZING PORE-FORMING TOXINS FOR THERAPEUTIC USES
(FR) PEPTIDES DÉRIVÉS DU RÉCEPTEUR DE MANNOSE POUR NEUTRALISER DES TOXINES FORMANT DES PORES POUR DES UTILISATIONS THÉRAPEUTIQUES
Abstract
(EN) A polypeptide or peptidomimetic comprising a sequence of at least 7 residues differing by residue substitutions, deletions or insertions numbering 0-2 compared to the sequence: GLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPTMSWNDINCEHLNNWICQ (SEQ ID NO: 1), for use as a medicament, in particular in pneumococcal disease.
(FR) L'invention concerne un polypeptide ou un peptidomimétique comprenant une séquence d'au moins 7 résidus différant par des substitutions, des délétions ou des insertions de résidus par rapport à la séquence : GLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPTMSWNDINCEHLNNWICQ (SEQ ID NO: 1), pour une utilisation en tant que médicament, en particulier en cas de maladie pneumococcique.
Latest bibliographic data on file with the International Bureau