Search International and National Patent Collections
Some content of this application is unavailable at the moment.
If this situation persists, please contact us atFeedback&Contact
1. (WO2016105536) MUC1 DECOY PEPTIDES FOR TREATMENT AND PREVENTION OF BACTERIAL INFECTIONS
Note: Text based on automatic Optical Character Recognition processes. Please use the PDF version for legal matters

WHAT IS CLAIMED IS:

1. A method of treating or preventing a bacterial infection in a subject, comprising administering a therapeutically effective amount of one or more MUCl decoy peptides to a subject in need thereof, wherein the one or more MUCl decoy peptide is selected from the group consisting of:

(a) a single repeat MUCl decoy peptide comprising at least 15 contiguous amino acids of GSTAPPAHGVTSAPDTRPAP (SEQ ID NO:l),

(b) a tandem repeat MUCl decoy peptide comprising at least five MUCl repeats, wherein each MUCl repeat comprises at least 15 contiguous amino acids of

GSTAPPAHGVTSAPDTRPAP (SEQ ID NO: l) and wherein the sequence of each MUCl repeat may vary in the peptide,

(c) an ectodomain MUCl decoy peptide comprising the amino acid sequence MTPGTQSPFFLLLLLTVLTVVTGSGHASSTPGGEKETSATQRSSVPSSTEKNAVSMTSSV LSSHSPGSGSSTTQGQDVTLAPATEPASGSAATWGQDVTSVPVTRPALGSTTPPAHDVTS APDNKPAPXGSTAPPAHGVTSAPDNRPALGSTAPPVHNVTSASGSASGSASTLVH GTS ARATTTPASKSTPFSIPSHHSDTPTTLASHSTKTDASSTHHSTVPPLTSSNHSTSPQLSTGV SFFFLSFHISNLQFNSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPG (SEQ ID NO:2), wherein X is at least five MUCl repeats, wherein each MUCl repeat comprises at least 15 contiguous amino acids of GSTAPPAHGVTSAPDTRPAP (SEQ ID NO:l) and wherein the sequence of each MUCl repeat may vary in the peptide,

(d) a sequence variant MUCl decoy peptide having at least 80% sequence identity to a peptide of (a), (b) or (c),

(d) a desialylated version of a peptide of (a), (b), (c) or (d), and

(e) a deglycosylated version of a peptide of (a), (b), (c) or (d).

2. The method of claim 1 wherein the MUCl decoy peptide is the ectodomain MUCl decoy peptide set forth in SEQ ID NO:3, or a desialylated version thereof, or a deglycosylated version thereof.

3. The method of claim 1 or 2, wherein the bacterial infection is treated.

4. The method of claim 1 or 2, wherein the bacterial infection is prevented.

5. The method of any one of claims 1 -4, wherein the bacterial infection is a .hospital-acquired (nosocomial) infection or a community-acquired infection.

6. The method of any one of claims 1 -5, wherein the bacterial infection is an infection selected from the group consisting of a pulmonary infection, a skin infection, a blood infection, a urinary tract infection, and an infection of the eye or ear.

7. The method of claim 6, wherein the pulmonary infection is an infection of the lungs of a subject with cystic fibrosis or a ventilator-associated pneumonia.

8. The method of claim 6, wherein the skin infection is a burn, wound, or infection of a surgical site.

9. The method of claim 6, wherein the blood infection is sepsis.

10. The method of any one of claims 1 -9, wherein the bacterial infection is caused by a bacteria selected from the group consisting of Pseudomonas aeruginosa, Helicobacter pylori, Campylobacter jejuni, Escherichia coli, Salmonella enterica, Burkholderia cenocepacia, Burkholderia pseudomallei, Stenotrophomonas maltophilia, Legionella pneumophila, Bordetella bronchiseptica, Enterobacter spp. , Neisseria gonorrhoeae, Bacillus cereus, Bacillus subtilis, Actinobacillus pleuropneumoniae, and Yersinia pseudotuberculosis.

1 1. The method of any one of claims 1 -10, wherein the one or more MUC1 decoy peptides are formulated in a pharmaceutical formulation comprising the peptides and a pharmaceutically acceptable carrier or diluent.

12. A method of determining whether a subject has been colonized by a selected bacteria, comprising screening a biological sample from a subject for shed MUC1 ectodomain, wherein when shed MUC 1 ectodomain is detected in the sample, the subject has been colonized by the selected bacteria.

13. The method of claim 12, wherein the bacteria is selected from the group consisting of Pseudomonas aeruginosa, Helicobacter pylori, Campylobacter jejuni, Escherichia coli, Salmonella enterica, Burkholderia cenocepacia, Burkholderia pseudomallei, Stenotrophomonas maltophilia, Legionella pneumophila, Bordetella bronchiseptica, Enterobacter spp. , Neisseria gonorrhoeae, Bacillus cereus, Bacillus subtilis, Actinobacillus pleuropneumoniae, and Yersinia pseudotuberculosis.

14. The method of claim 12 or 13, wherein the biological sample is bronchoalveolar lavage fluid (BALF), protected specimen brush (PSB) bronchial sample, endotracheal aspiration, or swabbing from an infected or potentially infected wound area.

15. The method of any one of claims 12-14, wherein the screening is via enzyme-linked immunosorbent assay (ELISA), lateral flow immunoassay, magnetic immunoassay, radioimmunoassay, fluorescent immunosassay, Western immunoblot assay, dot immunoblot assay, and slot immunoblot assay.

16. A method of determining whether a subject has an infection of a selected bacteria, comprising screening a biological sample from a subject for shed MUC l ectodomain, wherein when shed MUCl ectodomain is detected in the sample, the subject is determined to have an infection of the selected bacteria.

17. The method of claim 16, wherein the bacteria is selected from the group consisting of Pseudomonas aeruginosa, Helicobacter pylori, Campylobacter jejuni, Escherichia coli, Salmonella enterica, Burkholderia cenocepacia, Burkholderia pseudomallei, Stenotrophomonas maltophilia, Legionella pneumophila, Bordetella bronchiseptica, Enterobacter spp. , Neisseria gonorrhoeae, Bacillus cereus, Bacillus subtilis, Actinobacillus pleuropneumoniae, and Yersinia pseudotuberculosis.

18. The method of claim 16 or 17, wherein the biological sample is bronchoalveolar lavage fluid (BALF), protected specimen brush (PSB) bronchial sample, endotracheal aspiration, or swabbing from an infected or potentially infected wound area.

19. The method of any one of claims 16-18, wherein the screening is via enzyme-linked immunosorbent assay (ELISA), lateral flow immunoassay, magnetic immunoassay, radioimmunoassay, fluorescent immunosassay, Western immunoblot assay, dot immunoblot assay, and slot immunoblot assay.

20. A MUC l decoy peptide selected from the group consisting of:

(a) a single repeat MUC l decoy peptide comprising at least 15 contiguous amino acids of GSTAPPAHGVTSAPDTRPAP (SEQ ID NO: l ),

(b) a tandenrrepeat MUCl decoy peptide comprising at least five MUCl repeats, wherein each MUCl repeat comprises at least 15 contiguous amino acids of

GSTAPPAHGVTSAPDTRPAP (SEQ ID NO: l ) and wherein the sequence of each MUCl repeat may vary in the peptide,

(c) an ectodomain MUCl decoy peptide comprising the amino acid sequence MTPGTQSPFFLLLLLTVLTVVTGSGHASSTPGGEKETSATQRSSVPSSTEKNAVSMTSSV LSSHSPGSGSSTTQGQDVTLAPATEPASGSAATWGQDVTSVPVTRPALGSTTPPAHDVTS APDN PAPXGSTAPPAHGVTSAPDNRPALGSTAPPVH VTSASGSASGSASTLVHNGTS ARATTTPASKSTPFSIPSHHSDTPTTLASHSTKTDASSTHHSTVPPLTSSNHSTSPQLSTGV SFFFLSFHISNLQFNSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPG (SEQ ID NO:2), wherein X is at least five MUCl repeats, wherein each MUCl repeat comprises at least 15 contiguous amino acids of GSTAPPAHGVTSAPDTRPAP (SEQ ID NO:l) and wherein the sequence of each MUCl repeat may vary in the peptide,

(d) a sequence variant MUCl decoy peptide having at least 80% sequence identity to a peptide of (a), (b) or (c),

(d) a desialylated version of a peptide of (a), (b), (c) or (d), and

(e) a deglycosylated version of a peptide of (a), (b), (c) or (d).

21. The MUCl decoy peptide of claim 20, wherein the MUCl decoy peptide is the ectodomain MUCl decoy peptide set forth in SEQ ID NO:3, or a desialylated version thereof, or a deglycosylated version thereof.

22. A pharmaceutical formulation comprising one or more MUCl decoy peptides of claim 20 or 21 and a pharmaceutically acceptable carrier or diluent.