WIPO logo
Mobile | Deutsch | Español | Français | 日本語 | 한국어 | Português | Русский | 中文 | العربية |
PATENTSCOPE

Search International and National Patent Collections
World Intellectual Property Organization
Search
 
Browse
 
Translate
 
Options
 
News
 
Login
 
Help
 
Machine translation
1. (WO2001036448) PREPARATION AND COMPOSITION OF PEPTIDES USEFUL FOR TREATMENT OF AUTOIMMUNE AND TRANSPLANT RELATED GRAFT VERSUS HOST CONDITIONS
Latest bibliographic data on file with the International Bureau   

Pub. No.:    WO/2001/036448    International Application No.:    PCT/US2000/041646
Publication Date: 25.05.2001 International Filing Date: 27.10.2000
Chapter 2 Demand Filed:    15.05.2001    
IPC:
A61K 38/00 (2006.01), C07K 14/78 (2006.01), C07K 19/00 (2006.01)
Applicants: CEL-SCI CORPORATION [US/US]; Suite 802, 8229 Boone Boulevard, Vienna, VA 22182 (US) (For All Designated States Except US).
ZIMMERMAN, Daniel, H. [US/US]; (US) (For US Only)
Inventors: ZIMMERMAN, Daniel, H.; (US)
Agent: STEINBERG, Richard, A.; Sherman & Shalloway, 413 North Washington Street, Alexandria, VA 22314 (US)
Priority Data:
60/161,734 27.10.1999 US
Title (EN) PREPARATION AND COMPOSITION OF PEPTIDES USEFUL FOR TREATMENT OF AUTOIMMUNE AND TRANSPLANT RELATED GRAFT VERSUS HOST CONDITIONS
(FR) METHODES DE PREPARATION ET COMPOSITION DE CONSTRUCTIONS PEPTIDIQUES UTILES DANS LE TRAITEMENT D'ETATS AUTO-IMMUNES ET DE GREFFES LIEES A LA REACTION DU GREFFON CONTRE L'HOTE
Abstract: front page image
(EN)Peptide constructs including a first peptide segment which includes an amino acid sequence associated with autoimmune disease, asthma, allergy or xeno- or allograft transplantation rejections bonded directly or via a linker or spacer to a second peptide which binds to T cells and which will redirect the immune response from a harmful Th1 response to a less harmful Th2 response, or which will bind to T cells to initiate, but not complete, an immune response causing the T cells to which the first peptide binds, to undergo anergy and apoptosis, are useful in treating autoimmune conditions. For instance, the peptide construct NGQEEKAGVVSTGLIGGGDSAFDVLSFTAEEKAGVYK (SEQ ID NO:14) wherein Th2 stimulating Peptide G (SEQ ID NO:15) is covalently linked, via spacer GGG, to cardiac myosin molecule My1 (SEQ ID NO:16), can be used for treatment or prevention of myocarditis.
(FR)L'invention concerne des constructions peptidiques comprenant un premier segment peptidique contenant une séquence d'acides aminés, associée à une maladie auto-immune, à l'asthme, à l'allergie ou au rejet de greffe xéno- ou alogénique lors d'une transplantation, lié directement ou via un lieur ou un espaceur à un second peptide lié à des lymphocytes T, lequel réoriente la réponse immune d'une réponse Th1 nocive à une réponse Th2 moins nocive, lequel se fixe aux lymphocytes T pour déclencher, sans y mettre fin, une réponse immune, amenant les lymphocytes T auxquelles le premier peptide se fixe à subir une anergie et une apoptose. Ces constructions peptidiques sont utiles dans le traitement d'états auto-immunes. Par exemple, la construction peptidique NGQEEKAGVVSTGLIGGGDSAFDVLSFTAEEKAGVYK (SEQ ID NO :14) dans laquelle le peptide G stimulant Th2 (SEQ ID NO :15) est liée par covalence, via l'espaceur GGG, à la molécule de myosine cardiaque My1 (SEQ ID NO :16), peut être utilisée dans le traitement ou la prévention de la myocardite.
Designated States: AE, AG, AL, AM, AT, AU, AZ, BA, BB, BG, BR, BY, BZ, CA, CH, CN, CR, CU, CZ, DE, DK, DM, DZ, EE, ES, FI, GB, GD, GE, GH, GM, HR, HU, ID, IL, IN, IS, JP, KE, KG, KP, KR, KZ, LC, LK, LR, LS, LT, LU, LV, MA, MD, MG, MK, MN, MW, MX, MZ, NO, NZ, PL, PT, RO, RU, SD, SE, SG, SI, SK, SL, TJ, TM, TR, TT, TZ, UA, UG, US, UZ, VN, YU, ZA, ZW.
African Regional Intellectual Property Organization (GH, GM, KE, LS, MW, MZ, SD, SL, SZ, TZ, UG, ZW)
Eurasian Patent Organization (AM, AZ, BY, KG, KZ, MD, RU, TJ, TM)
European Patent Office (AT, BE, CH, CY, DE, DK, ES, FI, FR, GB, GR, IE, IT, LU, MC, NL, PT, SE)
African Intellectual Property Organization (BF, BJ, CF, CG, CI, CM, GA, GN, GW, ML, MR, NE, SN, TD, TG).
Publication Language: English (EN)
Filing Language: English (EN)