WIPO logo
Mobile | Deutsch | Español | Français | 日本語 | 한국어 | Português | Русский | 中文 | العربية |
PATENTSCOPE

Search International and National Patent Collections
World Intellectual Property Organization
Search
 
Browse
 
Translate
 
Options
 
News
 
Login
 
Help
 
Machine translation
1. (WO1997040149) AUTOANTIGEN AND PROTEINS STRUCTURALLY RELATED THERETO FOR USE IN IMMUNOTHERAPY OF AUTOIMMUNE DISEASES
Latest bibliographic data on file with the International Bureau   

Pub. No.:    WO/1997/040149    International Application No.:    PCT/EP1997/001903
Publication Date: 30.10.1997 International Filing Date: 15.04.1997
Chapter 2 Demand Filed:    11.10.1997    
IPC:
A01K 67/027 (2006.01), A61K 38/00 (2006.01), C07K 14/47 (2006.01)
Applicants: AKZO NOBEL N.V. [NL/NL]; Velperweg 76, NL-6824 BM Arnhem (NL) (For All Designated States Except US).
BOOTS, Anna, Maria, Helena [NL/NL]; (NL) (For US Only).
VERHEIJDEN, Gijsbertus, Franciscus, Maria [NL/NL]; (NL) (For US Only).
BOS, Ebo, Sybren [NL/NL]; (NL) (For US Only)
Inventors: BOOTS, Anna, Maria, Helena; (NL).
VERHEIJDEN, Gijsbertus, Franciscus, Maria; (NL).
BOS, Ebo, Sybren; (NL)
Agent: HERMANS, Franciscus, G., M.; P.O. Box 20, NL-5340 BH Oss (NL)
Priority Data:
08/634,493 18.04.1996 US
Title (EN) AUTOANTIGEN AND PROTEINS STRUCTURALLY RELATED THERETO FOR USE IN IMMUNOTHERAPY OF AUTOIMMUNE DISEASES
(FR) AUTO-ANTIGENE ET PROTEINES LIES DE MANIERE STRUCTURELLE ET LEUR UTILISATION DANS L'IMMUNOTHERAPIE DES MALADIES AUTO-IMMUNES
Abstract: front page image
(EN)The present invention relates to the use of autoantigen HC gp-39, and proteins comprising an amino acid sequence which exhibits at least 50 % homology with the amino acid sequence of HC gp-39, more particular with the amino acid sequence YKLVCYYTSWSQYREGDGSCFPDALDR-FLCTHIIYSFANISND (SEQ ID NO:1) in antigen-specific treatment of articular cartilage destruction in autoimmune diseases in mammals to induce systemic tolerance of the immune system. The autoantigen HC gp-39, and the arthritogenic proteins comprising an amino acid sequence which exhibits at least 50 % homology with the amino acid sequence YKLVCYYTSWSQYREGDGSCFPDALDR-FLCTHIIYSFANISND (SEQ ID NO:1) are also suitable to induce arthritis in animals, preferably mice. The invention furthermore relates to pharmaceutical compositions comprising said autoantigen and/or said arthritogenic proteins, a diagnostic method for the detection of autoreactive T cells in a test sample and test kits to be used in said method.
(FR)La présente invention se rapporte à l'utilisation de l'auto-antigène HC gp-39 et aux protéines comprenant une séquence d'acides aminés qui présente au moins une homologie de 50 % avec la séquence d'acides aminés de HC gp-39, notamment avec la séquence d'acides aminés YKLVCYYTSWSQYREGDGSCFPDALDR-FLCTHIIYSFANISND (NO ID SEQ: 1) dans le traitement, spécifique de l'antigène, de la destruction du cartilage articulaire dans les maladies auto-immunes chez les mammifères afin d'induire une tolérance systémique du système immun. L'auto-antigène HC gp-39 et les protéines arthritogènes comprenant une séquence d'acides aminés qui présente au moins une homologie de 50 % avec la séquence d'acides aminés YKLVCYYTSWSQYREGDGSCFPDALDR-FLCTHIIYSFANISND (NO ID SEQ: 1) sont également appropriés pour induire l'arthrite chez des animaux, de préférence les souris. L'invention se rapporte également à des compositions pharmaceutiques comprenant l'auto-antigène et/ou les protéines arthritogènes, à un procédé de diagnostic destiné à détecter les lymphocytes T autoréactifs dans un échantillon test et à des kits de test devant être utilisés dans ce procédé.
Designated States: AM, AU, BB, BG, BR, CA, CN, CZ, EE, GE, HU, IS, JP, KG, KP, KR, LK, LR, LT, LV, MD, MG, MN, MX, NO, NZ, PL, RO, RU, SG, SI, SK, TR, TT, UA, US, UZ, VN.
African Regional Intellectual Property Organization (GH, KE, LS, MW, SD, SZ, UG)
Eurasian Patent Organization (AM, AZ, BY, KG, KZ, MD, RU, TJ, TM)
European Patent Office (AT, BE, CH, DE, DK, ES, FI, FR, GB, GR, IE, IT, LU, MC, NL, PT, SE)
African Intellectual Property Organization (BF, BJ, CF, CG, CI, CM, GA, GN, ML, MR, NE, SN, TD, TG).
Publication Language: English (EN)
Filing Language: English (EN)