Processing

Please wait...

Settings

Settings

1. BRPI0612778 - ANTICORPOS HUMANIZADOS ANTI-ALFAVBETA6, MÓLECULA DE ÁCIDO NUCLÉICO E PEPTÍDEO ISOLADOS, VETOR RECOMBINANTE E COMPOSIÇÃO

Note: Text based on automatic Optical Character Recognition processes. Please use the PDF version for legal matters

Relatório Descritivo da Patente de Invenção para "ANTICORPOS ANTI-ALFAvBETAe E USOS DESTES".
Antecedentes da Invenção
Campò da Invenção
A presente invenção está inserida nos campos da biologia celular, imunologia e oncologia. Especificamente, a invenção refere-se a anticorpos humanizados que reconhecem as integrinas Ονββ, compreendendo uma região variável de origem não humana e pelo menos uma porção de uma imunoglobulina de origem humana. A invenção refere-se também a proces- sos para sua preparação, a composições farmacêuticas compreendendo os mesmos e a métodos para tratar várias doenças por administração dos anticorpos anti-ανββ humanizados. A invenção ainda refere-se à identificação de expressão diferencial da integrioa Ονββ nas superfícies das células tumorais e tecidos, o uso desta expressão diferencial na determinação do potencial metastático de células tumorais e métodos de diagnóstico e de tratamento/prevenção de metástase de tumor e para eliminação de células tumorais metastáticas residuais usando ligantes, particularmente anticorpos, que se ligam à integrina θνβ6.
\ Técnica Relacionada
Integrinas são receptores de glicoproteína de superfície celular, que ligam proteínas de matriz extracelular e medeiam as interações célula- célula e célula-matriz extracelular (geralmente referidas como eventos de adesão celular) (Ruoslahti, É., J. Clin. Invest. 87:1-5 (1991 ); Hynes, R.O., Celi 69:11 -25 (1992)). Esses receptores são compostos de cadeias alfa (a) e beta (β) não covalentemente associadas que se combinam para dar uma variedade de proteínas heterodiméricas com distintas especificidades célula- i res e adesivas (Albeda, S.M., Lab. Invest. 68:4-14 (1993)). Estudos recentes têm implicado certas integrinas na regulação de uma variedade de processos celulares, incluindo adesão, migração, invasão, diferenciação, prolifera- ção, apoptose e expressão de genes celulares (Albeda, S.M., Lab. Invest. 68:4-14 (1993); Juliano, R., Câncer Met. Rev. 13:25-30 (1994); Ruoslathi, E. e Reed, J.C., Celi 77:477-478 (1994); e Ruoslahti, E. e Giancotti, F.G., Câncer Celis 1 :199-126 (1989); Plow, Haas et al. 2000; vand der Flier e Sonnenberg 2001 ).
O receptor ανββ é um membro de uma família de integrinas que são expressas como proteínas heterodiméricas de superfície celular (Busk, M. et al, J. Biol. Chem. 267(9):5790-5796 (1992)). Embora a subunidade av possa formar um heterodímero com uma variedade de subunidades (β-ι , β3, βδ. ββ e ββ). a subunidade β6 pode ser somente expressa como um heterodímero com a subunidade ov. A integrina ανββ é conhecida como sendo um receptor de superfície celular de ligação de fibronectina, peptídeo associado à latência (LAP) e tenacina C, interagindo com a matriz extracelular através dos sítios de ligação tripeptídicos RGD sobre ela. (Busk, M. et al, J. Biol. Chem. 267:5790-5796 (1992); Weinacker, A. et al, J. Biol. Chem. 269:6940-6948 (1994); Prieto, A.L et al, Proc. Natl. Acad. ScL USA 90:10154-10158 (1993)). Embora a integrina θνβ6 tenha sido primeiramente identificada e sequenciada há mais de dez anos, a significância biológica da ανββ, especialmente em doença, está ainda sob investigação. A expressão de ανββ é restrita às células epiteliais, em níveis relativamente baixos, em tecido saudável e significantemente supra-regulado durante o desenvolvimento, lesão, e cura de ferimentos (Breuss, J.M. et al, J. Histochem. Cytochem. 41 :1521-1527 (1993); Breuss, J.M. et al, J. Celi Sei. 108:2241-2251 (1995); Koivisto, L et al, Celi Adhes. Communic. 7:245- 257 (1999); Zambrano, G. et al, J. Celi Biol. 129(3):853-865 (1995); Hakkinen, L. et a.l, J. Histochem. Cytochem. 48(6): 985-998 (2000)). Um número crescente de relatórios recentes demonstra que ανββ é supra-regulada em cânceres de origem epitelial, incluindo carcinoma do cólon (Niu, J. et al., Int. J. Câncer 92:40-48 (2001 ); Bates, R.C. et al., J. Clin. Invest. 775:339-347 (2005)), câncer do ovário (Ahmed, N. et al., J. Celi Biochem. 84:675-686 (2002); Ahmed, N. et al., J. Histochem. Cytochem. 50:1371-1379 (2002); Ahmed, N. et al., Carcinogen. 23:237-244 (2002)), carcinoma de célula escamosa (Koivisto, L. et al, Exp. Celi Res. 255:10-17 (2000); Xue, H. et al., Biochem. Biophys. Res. Comm. 288:610-618 (2001 ); Thomas, G.J. et al., J. Invest. Dermatol. 117:67-73 (2001); Thomas, G.J. et al., Int. J. Câncer 92:641 -650 (2001 ); Ramos, D.M. et al., Matrix Biol. 21 :297-307 (2002); (Agrez, M. et al., Br. J. Cancer 81 :90-97 (1999); Hamidi, S. et al, Br. J. Cancer 82(8): 1433- 1440 (2000); Kawashima, A. et al., Pathol. Res. Pract. 99(2):57-64 (2003)), e câncer da mama (Arihiro, K. et al., Breast Cancer 7:19-26 (2000)). Tem também sido reportado que a subuni- dade o tem sido envolvida na metástase de tumor e que o bloqueio desta subunidade pode, consequentemente, prevenir metástase (para uma revisão, vide Imhof, B. A. et al., em: "Attempts to Understand Metastasis Forma- tion , U. Gunthert e W. Birchmeier, eds., Berlim: Springer- Verlag, pp. 195-203 (1996)).
A integrina θνβ6 tem múltiplas funções reguladoras na biologia da célula tumoral. Estudos recentes demonstraram que os domínios extrace-lulares e citoplasmáticos da subunidade β6 medeiam diferentes atividades celulares. Os domínios extracelulares e transmembrânicos têm mostrado que medeiam a atividade e adesão de TGF-β (Sheppard, D., Cancer and Metastasis Rev. 24:395-402 (2005); Munger, J.S. et al., Celi 96:319-328 (1999)). O domínio citoplasmático da subunidade β6 contém uma única sequência de 1 1 aminoácidos que é importante para mediar a proliferação celular regulada por ανβ6, produção de MMP, migração, e pró-sobrevivência (Li, X. et al., J. Biol. Chem. 278(43):41646-41653 (2003); Thomas, G.J. et al., J. Invest. Derm. 117(1 ):61 - 73 (2001 ); Thomas, G.J. et al., Br. J. Cancer 87(8):859-867 (2002); Janes, S.M. e Watt, F.M., J. Celi Biol 166(3) :419-431 (2004)). A subunidade β6 tem sido clonada, expressa e purificada (Sheppard et al., Patente. US 6.787.322 B2, cuja exposição é aqui incorporada a título de referência em sua totalidade), e anticorpos bloqueadores de função que se ligam seletivamente à integrina θνβ6 têm sido relatados (Weinreb et al., J. Biol. Chem. 279: 17875-17877 (2004), cuja exposição é aqui incorporada a título de referência em sua totalidade). Antagonistas de θν 6 (incluindo certos anticorpos monoclonais) têm sido também sugeridos como possíveis tratamentos para certas formas de lesão pulmonar aguda (vide Patente US. 6.692.741 B2 e WO 99/07405, cuja exposição é aqui incorporada a título de referência em sua totalidade).
ανββ pode se ligar a vários ligantes incluindo fibronectina, tenas- cina, e peptídeos 1 e 3 associados à latência (LAP1 e LAP 3), os 278 aminoácidos N-terminais da forma de precursor latente de TGF-βι através de uma interação direta com um motivo de arginina-glicina-aspartato ("RGD") (Busk, M. et al., J. Biol. Chem. 267(9) :5790-5796 (1992); Yokosaki, Y. et al., J. Biol. Chem. 271 (39):24144-24150 (1996); Huang, X.Z. et al., J. Celi Sei. 111 :2189-2195 (1998); Munger, J.S. et al., Celi 96:319-328 (1999)). A citocina TGF-β is sintetizada como um complexo latente que tem o LAP N-terminal não covalentémente associado à citocina TGF-β C-terminal, ativa, madura. O complexo de TGF-β latente pode se ligar a seu receptor cognato e assim não é biologicamente, ativo até ser convertido em uma forma ativa (Barcel- los-Hoff, M.H., J Mamm. Gland Biol. l(4):353-363 (1996); Gleizes, P E. et al., Stern Celis 15(3) :190-197 (1997); Munger, J.S. et al., Kid. Int. 57:1376-1382 (1997); Khalil, N., Microbes Infect. 1 (15):1255-1263 (1999)). A ligação de θνββ ao LAP1 ou LAP3 leva à ativação da forma de precursor latente de TGF-βΙ e TGF^3 (Munger, J.S. et al., Celi 96:319-328 (1999)), proposta como resultado de uma alteração conformacional na complexo latente permitindo que TGF-β se ligue ao seu receptor. Assim, a expressão supra-regulada de Ονββ pode levar à ativação local de TGF-β, que por sua vez pode ativar uma cascata de eventos a jusante.
A citocina TGF-βΙ é um fator de crescimento pleiotrópico que regula a proliferação celular, diferenciação, e respostas imunes (Wahl, S.M., J. Exp. Med. 80:1587-1590 (1994); Massague, J Annu. Rev. Biochem. 67:753-191 (1998); Chen, W. e Wahl, S.M., TGF-β: Receptors, Signaling Pa-thways and Autoimmunity, Basel: Karger, pp. 62-91 (2002); Thomas, D.A. e Massague, J., Câncer Celi 5:369-380 (2005)). O papel que TGF-βΙ desempenha no câncer tem dois lados. TGF-β é reconhecido ainda por atividade supressora e inibidora de crescimento, muitos tumores evolvem resistência às atividades supressoras de crescimento de TGF-βΙ (Yingling, J.M. et al., Nature Rev. Drug Discov. 3(12): 1011-1022 (2004); Akhurst, RJ. et al., Trends Celi Biol. 1 1 (11):S44- S51 (2001 ); Balmain, A. e Akhurst, R.J., Nature 428(6980):271 -272 (2004)). Em tumores estabelecidos, a expressão e atividade de TGF-βΙ têm sido implicadas na sobrevivência, progressão, e metás- tases do tumor (Akhurst, RJ. et al., Tren s Celi Biol. 11 (11 ):S44-S51 (2001 ); Muraoka, R.S. et al'., J. Clin. Invest. 109(12): 1551 (2002); Yang, Y.A. et al., J. Clin. Invest. 109(12): 1607-1615 (2002)). É postulado que isso seja mediado por ambos os efeitos autócrinos e parácrinos no ambiente tumor-estromal local, incluindo os efeitos de TGF-β sobre a vigilância imune, angiogênese, e pressão intersticial tumoral aumentada. Agora vários estudos têm mostrado os efeitos antitumorais e antimetastáticos de inibir TGF-βΙ (Akhurst, R.J., J. Clin. Invest. 109(12):1533-1536 (2002); Muraoka, R.S. et al., J. Clin. Invest. 109(12):I55I (2002); Yingling, J.M. et al., Nat. Rev. Drug Discov. 3(12): 1011- 1022 (2004); Yang, Y.A. et al., J. Clin. Invest. 109(J 2):I607- 1615 (2002); Haider, S.K. et al., Neoplasia 7(5):509-521 (2005); lyer, S. et al., Câncer Biol. Ther. 4(3):26l-266 (2005)).
Expressão aumentada de θνβ6 sobre tumores, particularmente na interface tumor-estromal, pode refletir uma mecanismo único para a ati-vação local de TGF-βΙ e a habilidade de promover sobrevivência, invasão, e metástase do tumor. O alto nível de expressão em metástases humanas leva à suposição de um papel potencial para θνβ6 no estabelecimento de metástases, que é consistente com os relatos anteriores que Ονβε pode mediar transição epitelial para mesenquimal, invasão de células tumorais in vitro, e expressão correlacionada com metástases em um modelo de camundongo (Bates, R.C., et al., J. Clin. Invest, 115(2):339-347 (2005); Thomas, G.J. et al., Br. J. Câncer 87(8)859-867 (2002); Morgan, M.R. et al., J. Biol. Chem. 279(25):26533-26539 (2004)).
Descreveu-se anteriormente a geração de anticorpos monoclo-nais
potentes e seletivos (mAbs) que se ligam a ambas as formas humanas e murinas de ο ββ e bloqueiam a ligação de Ονββ a seus ligantes e a ativação mediada por θνβ6 do TGF-βΙ (Weinreb, P.H. et al., J. Biol. Chem. 279( 7):17875-17887 (2004)). Como também descrito na Publicação de PCT WO 03/100033, aqui incorporada a título de referência em sua totalidade, os anticorpos contra νββ, incluindo a identificação e análise de resíduos de a-minoácidos-chave nas regiões determinantes de complementaridade (CDRs) de tais anticorpos foram descobertos e caracterizados. Em particular, esses anticorpos de alta afinidade (a) se ligam especificamente a θνββΐ (b) inibem a ligação de θνββ ao seu ligante tais como LAP, fibronectina, vitronectina, e tenascina com um valor de IC50 menor que 10D5 (Pedido de Patente Internacional WO 99/07405); (c) bloqueiam a ativação de TGF-β; (d) contêm certas sequências de aminoácidos nas CDRs que proporcionam especificidade de ligação para Ονββ; (e) se ligam especificamente à subunidade ββ; e/ou (f) reconhecem Ονββ em procedimentos de imunocoloração, tal como imunoco- loração de tecidos embutidos em parafina.
WO 03/100033 descreve também a constatação que anticorpos que se ligam a ανββ podem ser agrupados em classes e subclasses biofisi-camente distintas. Uma classe de anticorpos exibe a habilidade de bloquear a ligação de um ligante (por exemplo, LAP) a Ονββ (bloqueadores). Essa classe de anticorpos pode ser ainda dividida em subclasses de bloqueadores dependentes de cátion e bloqueadores independentes de cátions. Alguns dos bloqueadores dependentes de cátion contêm uma sequência de peptí-deos de arginina-glicina-aspartato (RGD), ao passo que os bloqueadores independentes de cátion não contêm uma sequência de RGD. Uma outra classe de anticorpos exibe a capacidade de se ligar a ανββ e ainda não bloqueia a ligação de ανββ a um ligante (não-bloqueadores).
Além disso, WO 03/100033 refere-se a anticorpos que compreendem cadeias -pesadas e cadeias leves, cujas regiões determinantes de complementaridade (CDR) 1 , 2 e 3 consistem em certas sequências de aminoácidos que proporcionam especificidade de ligação para θνβ6. WO 03/100033 proporciona também anticorpos que se ligam especificamente a ανββ, mas não inibem a ligação de ο ββ a peptídeo associado à latência (LAP), bem como anticorpos que se ligam ao mesmo epítopo.
WO 03/100033 ainda descreve células de hibridomas 6.1A8, 6.2B10, 6.3G9, 6.8G6, 6.2BI, 6.2AI, 6.2E5, 7.1 G10, 7.7G5, e 7.1 C5, isoladas de ácidos nucléicos compreendendo sequências de codificação e polipeptí-deos isolados compreendendo sequências de aminoácidos dos anticorpos
Em particular WO 03/100033 descreve sequências de aminoácidos dos anticorpos
compreendendo sequências de polipetídeos de ca- deias pesada e leve como anticorpos produzidos pelos hibridomas 6.1 A8, 6.3G9, 6.8G6, 6.2BI, 6.2B10, 6.2AI, 6.2E5, 7.1 G10, 7.7G5, ou 7.1 C5. Vários dos hibridomas foram depositados no American Type Culture Collection ("ATCC"; P.O. Box 1549, Manassas, VA 20108, E.U.A.) sob o Tratado de Budapeste. Em particular, os clones de hibridomas 6.3G9 e 6.8G6 foram depositados em 26 de agosto de 2001 , e contêm os números de identificação ATCC PTA-3649 e PTA-3645, respectivamente. Os anticorpos murinos produzidos pelos hibridomas 6.3G9 e 6.8G6 estão sendo ainda explorados na presente invenção quanto ao seu potencial desenvolvimento como anticorpos humanizados.
O anticorpo monoclonal murino 3G9 é um anticorpo murino, lgG1 , isolado do camundongo -/- integrina β6 (Huang et al., J. Celi Biol. 133:921 -928 (1996) imunizado com θνββ solúvel. O anticorpo 3G9 reconhece especificamente o epítopo da integrina θνββ que é expresso em níveis supra-regulados durante lesão, fibrose e câncer (vide, por exemplo, Thomas et al., J. Invest. Dermatology 1 17:67-73 (2001 ); Brunton et al., Neoplasia 3:215-226 (2001 ); Agrez et al., Int. J. Câncer 81 :90-97 (1999); Breuss, J. Celi Science 108:2241 -2251 (1995)). Ele não se liga a outras integrinas Ov e apresenta reação cruzada a ambas as moléculas humanas e murinas. O anticorpo monoclonal murino 3G9 tem sido descrito como bloqueador da ligação de Ονβε ao LAP conforme determinação por bloqueio de ligação de ligante tanto a θνββ como às células que expressam βε, inibindo assim a atividade pró-fibrótica de TGF-β (vide WO 03/100033). Foi também mostrado que inibe a ativação mediada por ο βε de TGF-β com um valor de IC5o menor que um dos anticorpos θνβ6 conhecidos, 10D5 (Huang et al., J Celi Sei. 1 1 1 :2189-2195 (1998)).
O anticorpo monoclonal murino 8G6 é anticorpo kappa murino lgG1 , que também reconhece o epítopo de integrina θνββ, conforme descrição em WO 03/1 00033. O anticorpo monoclonal murino 8G6 é um bloqueador de ο βθ, de alta afinidade, dependente de cátion, que exibe a capacidade de inibir ativação de TGF-β mediada por ανββ com um valor de IC5o menor que 10D5 (vide WO 03/100033).

Ambos os anticorpos murinos 3G9 e 8g6 foram eficazes em prevenir fibrose do rim e pulmão, conforme descrição em WO 03/100033. Além disso, o anticorpo murino 3G9 foi capaz de inibir eficazmente o crescimento de tumor em um modelo de xenoenxerto de tumor humano, sugerindo o papel potencial de ανβε na patologia do câncer e a eficácia de tal bloqueio usando anticorpos direcionados em ο βθ- Por conseguinte, é necessário o desenvolvimento de anticorpos ανββ que sejam menos antigênicos em seres humanos e que possam ser úteis no tratamento de doenças envolvidas na por meio de de ανββ. O advento da metodologia de DNA recombinante, tornou possível engenheirar estruturalmente genes de anticorpos e produzir moléculas modificadas de anticorpos com propriedades não obteníveis por tecnologia de hibridoma. Na arena terapêutica, um objetivo dessa metodologia tem sido a redução da imunogenicidade em seres humanos de anticorpos monoclonais de roedores por modificação de sua estrutura de aminoácidos primários. A redução da imunogenicidade de anticorpos terapêuticos é desejável porque a indução de uma resposta imune pode provocar um espectro de efeitos adversos em um paciente, que varia da eliminação acelerada do anticorpo terapêutico, com a consequente perda de eficácia, até a anafilaxia fatal no caso mais extremo.
Uma estratégia para reduzir a imunogenicidade de anticorpos monoclonais estranhos tem sido substituir os domínios constantes de cadeias, leve e pesada, do anticorpo monoclonal com domínios análogos de origem humana, deixando intactos os domínios de regiões variáveis do anticorpo estranho intactos. Os domínios de regiões variáveis das cadeias leves e pesadas são responsáveis pela interação entre o anticorpo e o antígeno. Moléculas de anticorpo quimérico tendo domínios variáveis de camundongos unidos a domínios constantes humanos se ligam usualmente ao anticorpo com a mesma constante de afinidade que o anticorpo do camundongo do qual o quimérico é derivado. Tais anticorpos quiméricos são menos imuno-gênicos em seres humanos que seus equivalentes integralmente murinos. No entanto, anticorpos que conservam os domínios variáveis murinos intei- ros tendem a provocar respostas imunes numa porção substancial de pacientes.
Era previsível que seres humanos montariam uma resposta imune para domínios variáveis inteiros; assim, esforços para obter domínios variáveis com caráter humano tinham sido iniciados mesmo antes das experiências clínicas de tais anticorpos quiméricos padrão terem sido reportadas. Uma categoria de métodos frequentemente referida como "humanizante" tem por objetivo converter os domínios variáveis de anticorpos monoclonais murinos em uma forma humana através da construção de, de modo recom- binante, de um domínio variável de anticorpo tendo tanto o caráter de camundongo como de seres humano. Categorias humanizantes são baseadas em vários entendimentos consensuais de dados das estruturas dos anticorpos. Em primeiro lugar, domínios variáveis contêm extensões contíguas de sequência de peptídeos que são conservadas dentro de uma espécie, mas que diferem entre as espécies de evolução remota, tais como camundongos e seres humanos. Em segundo lugar, outras extensões contíguas não são conservadas dentro de uma espécie, mas ainda diferem entre as células produtoras de anticorpos dentro do mesmo indivíduo. Em terceiro lugar, con-tatos entre anticorpo e antígeno ocorrem principalmente através das regiões não conservadas do domínio variável. Em quarto lugar, a arquitetura molecular dos domínios variáveis de anticorpo é suficientemente similar através das espécies cujas posições dos resíduos de aminoácidos correspondentes entre espécies podem ser identificadas com base na posição sozinha, sem dados experimentais.
Estratégias humanizadas compartilham a premissa que substituição de resíduos de aminoácidos que são característicos de sequências mu-rinas com resíduos encontrados nas posições correspondentes de anticorpos humanos reduzirá a imunogenicidade em seres humanos do anticorpo resultante. Contudo, a substituição de sequências entre espécies resulta u-sualmente na redução do anticorpo que se liga a seu antígeno. Portanto, a técnica de humanização reside em equilibrar a substituição da sequência murina original para reduzir a imunogenicidade com a necessidade da molé- cuia humanizada de reter ligação de antígeno suficiente para ser terapeuti- camente útil. Esse equilíbrio tem sido tentado com o uso de duas abordagens.
Em uma abordagem, exemplificada na Patente US 5.869.619, resíduos caracteristicamente humanos são usados no lugar de resíduos de domínio variável murino que são determinados e prognosticados (i) para não desempenhar papel significante na interação com antígenos e (ii) para ser posicionado com duas cadeias laterais que se projetam no solvente. Assim, resíduos exteriores remotos do sítio de ligação de antígeno são humanizados, enquanto os resíduos anteriores, resíduos de ligação de antígenos, e resíduos que formam a interface entre os domínios variáveis permanecem murinos. Uma desvantagem dessa abordagem é que são requeridos dados experimentais bastantes dispendiosos para determinar se o resíduo não desempenha papel químico significante na ligação de antígeno ou será posicionado no solvente em uma estrutura do anticorpo tridimensional.
Em uma outra abordagem mais geral, exemplificada na Patente US 5.225.539, extensões contíguas de sequência de peptídeos de domínios variáveis conservadas são substituídas com as extensões correspondentes de um anticorpo humano. Nessa abordagem mais geral, todos os resíduos de domínio variável são humanizados, exceto as regiões não conservadas implicadas na ligação de antígeno. Para determinar extensões contíguas apropriadas para substituição, a Patente US 5.225.539 utilizou uma classificação de sequências de domínios variáveis de anticorpos que haviam sido desenvolvidas previamente por Wu e Kabat, J Exp Med. 132(2):211-250 (1970).
Wu e Kabat foram os pioneiros no alinhamento de sequências de peptídeos de anticorpos, e suas contribuições a este respeito tiveram vários desdobramentos: Em primeiro lugar, através do estudo de similaridades de sequências entre vários domínios, eles identificaram resíduos correspondentes que em um maior ou menor grau eram homólogos através de todos os anticorpos em todas as espécies vertebradas, visto que eles adotaram estrutura tridimensional similar, desempenharam papéis funcionais similares, interagiram de forma similar com os resíduos vicinais, e existiam em ambientes químicos similares. Em segundo lugar, eles arquitetaram um sistema de numeração de sequências de peptídeos onde os resíduos de imunoglobulina homólogos foram designados como estando no mesmo número de posição. Aquele versado na técnica pode de forma indubitável designar o que é agora mais comumente chamado de numeração de Kabat, para qualquer sequência de domínios variáveis, sem se basear em qualquer dado experimental além da própria sequência. Em terceiro lugar, para cada posição de sequência numerada por Kabat, Kabat e Wu calcularam a variabilidade, através do que é referido o achado de poucos ou muitos aminoácidos possíveis quando as sequências de domínios variáveis são alinhadas. Eles identificaram três regiões contíguas da alta variabilidade embutidas em quatro regiões contíguas menos variáveis. Outros pesquisadores haviam previamente observado variabilidade aproximadamente nessas regiões (regiões hipervariáveis) e postularam que a regiões altamente variáveis representavam resíduos de aminoácidos usados para ligação de antígenos. Kabat e Wu demarcaram formalmente resíduos que constituíam essas extensões variáveis, e as designaram como "regiões determinantes de complementaridade" (CDRs), re-ferindo-se à complementaridade química entre anticorpo e antígeno. Um papel na dobradura tridimensional do domínio variável, mas não em reconhecimento de antígeno, foi atribuído às regiões menos variáveis, que são agora -denominadas de "regiões de estrutura". Em quarto lugar, Kabat e Wu estabeleceram uma base de dados pública de sequências de peptídeos de anticorpo e de ácidos nucléicos, que continua a ser mantida e é bem-conhecida daqueles versados na técnica.
O método de humanização descrito na Patente US 5.225.539, ao usar a classificação de Kabat, resulta em um anticorpo quimérico que compreende CDRs de um anticorpo e regiões de estrutura provenientes de um outro anticorpo que difere da origem da espécie, especificidade, subclasse, ou outras características. Contudo, nenhuma sequência ou propriedade em particular foi atribuída às regiões de estrutura, certamente, a Patente US 5.225.539 ensinou que qualquer conjunto de estruturas poderia ser combi- nada com quaisquer grupos de CDRs. Sequências de estruturas têm, desde então, sido reconhecidas como sendo importantes para conferir a estrutura tridimensional de uma região variável de anticorpo necessária para reter boa ligação de antígeno. Desenvolvimentos subsequentes no campo têm sido refinamentos dentro do escopo da Patente US 5.225.539 para lidar com perda de avidez por antígeno observado com alguns anticorpos humanizados com relação à avidez dos anticorpos de camundongo correspondentes.
A Patente US 5.693.761 descreve um refinamento sobre a Patente US 5.225.539 para humanizar anticorpos, e é baseado na premissa que atribui perda de avidez a problemas nos motivos estruturais na estrutura humanizada, que, devido a sua incompatibilidade esférica ou outra incompatibilidade química, interferem na dobradura dos CDRs para a conformação capaz de ligação encontrada no anticorpo de camundongo. Para tentar resolver esse problema, a Patente US 5.693.761 ensina o uso de sequências de estruturas humanas intimamente homólogas em sequências de peptídeos lineares para sequências de estruturas do anticorpo de camundongo a ser humanizado. Por conseguinte, os métodos da Patente US 5.693.761 foca na comparação de sequências de estrutura entre espécies. Tipicamente, todas as sequências de domínios variáveis humanos são comparadas a uma particular sequência de camundongo e é calculada a identidade de percentagem entre os resíduos de estrutura correspondentes. O domínio variável humano com a maior percentagem é selecionado para proporcionar as sequências de estrutura para humanizar o projeto. A Patente US 5.693.761 ensina também que é importante reter, na estrutura humanizada, certos resíduos de aminoácidos provenientes da estrutura de camundongo crítica para suportar as CDRs em uma conformação capaz de ligação.
Em outras abordagens, a criticalidade dos resíduos de aminoácidos de estrutura particulares é determinada experimentalmente uma vez que uma construção humanizada de baixa avidez é obtida, por reversão de resíduos simples para a sequência de camundongos e efetuando ensaios de ligação de antígeno conforme descritos por Riechamnn et al., Nature 332(6162):323-327 (1988). Um outro exemplo de abordagem para identificar a criticalidade dos aminoácidos em sequências de estruturas é mostrado na Patente US 5.821.337 e Patente US 5.859.205. Essas referências descrevem específicas posições de resíduos de Kabat na estrutura, que, em um anticorpo humanizado pode requerer substituição com o aminoácido de camundongo correspondente para conservar a avidez. Por conseguinte, as estruturas resultantes construídas, que são parte humana e parte de camundongo, exibem ainda frequentemente imunogenicidade humana o ligação de antígeno diminuída, requerendo assim iterações numerosas na construção da estrutura para obter uma estrutura adequada para usos terapêuticos.
Existe, portanto, uma necessidade na técnica pelo desenvolvimento de anticorpos ανβε que são menos antigênicos em seres humanos. A presente invenção proporciona a geração de anticorpos humanizados que são especificamente reativos com ανβ6. A presente invenção proporciona também métodos para produzir tais anticorpos humanizados ao fornecer anticorpos humanizados que identificam confiavelmente sequências de estruturas humanas adequadas para suportar regiões CDR não humanas e ainda proporciona anticorpos humanizados que retêm alta ligação de antígeno com baixa imunogenicidade em seres humanos. A presente invenção também proporciona usos de tais anticorpos humanizados reativos com Ονββ no tratamento, diagnóstico e/ou prevenção de várias doenças e distúrbios.
Beve Sumário da Invenção
A presente invenção é baseada pelo menos em parte na descoberta e caracterização de anticorpos humanizados de alta afinidade contra ανβ6, incluindo a identificação e análise de resíduos de aminoácidos chave nas regiões determinantes de complementaridade (CDRs) de tais anticorpos, bem como a identificação e análise de resíduos de aminoácidos críticos nas sequências de estruturas.
Em uma modalidade, a presente invenção refere-se a anticorpos monoclonais humanizados tendo especificidade para integrinas θνββ, em que o anticorpo compreende domínios variáveis de cadeias pesada e leve de SEQ ID NO:1 e SEQ ID NO:2, respectivamente. Tais anticorpos humanizados são derivados da humanização do anticorpo murino 3G9. Em certas modalidades, os anticorpos humanizados compreendem uma cadeia pesada cujas regiões determinantes de complementaridade (CDR) 1 , 2 e 3 são definidas pelos resíduos de aminoácidos 31 -35, 50-65 e 98-109, respectivamente, da SEQ ID NO:1. Em certas modalidades, os anticorpos humanizados compreendem uma cadeia leves cujas CDRs 1 , 2 e 3 são definidas pelos resíduos de aminoácidos 24-35, 51 -57 e 90-98, respectivamente, da SEQ ID NO:2. Em certas modalidades, os anticorpos humanizados compreendem uma cadeia pesada cujas regiões de estrutura (FR) 1 , 2, 3 e 4 são definidas pelos resíduos de aminoácidos 1 -30, 36-49, 66-97 e 110-120, respectivamente, da SEQ ID NO:1. Em certas modalidades, os. anticorpos humanizados compreendem uma cadeia leve cujas regiões de estrutura (FR) 1 , 2, 3, e 4 são definidas pelos resíduos de aminoácidos 1 -23, 36-50, 58-89 e 99-108, respectivamente, da SEQ ID NO:2.
Em certas modalidades, os anticorpos humanizados compreendem pelo menos uma das seguintes substituições de aminoácidos na cadeia pesada, que consiste em Q3M e N74S da SEQ ID NO:1. Em certas modalidades, os anticorpos humanizados compreendem pelo menos uma das seguintes substituições de aminoácidos na cadeia leve consistindo em E1Q, L47W, 158V, A560V e Y87F da SEQ ID NO:2.
Em certas modalidades, o anticorpo humanizado compreende uma versão 1 de cadeia pesada ("HV1 "), em que a cadeia pesada consiste em substituições de aminoácidos Q3M e N74S da SEQ ID NO:1. Em certas modalidades, o anticorpo humanizado compreende uma versão 2 de cadeia pesada ("HV2"), em que a cadeia pesada consiste na substituição de aminoácido N74S da SEQ ID NO:1. Em certas modalidades, o anticorpo humanizado compreende um versão 3 de cadeia pesada ("HV3"), em que a cadeia pesada consiste na SEQ ID NO:1.
Em certas modalidades, o anticorpo humanizado compreende uma versão 1 de cadeia leve ("LV1 "), em que a cadeia leve consiste nas substituições de aminoácidos L47W, I58V, A60V e Y87F da SEQ ID NO:2. Em certas modalidades, o anticorpo humanizado compreende uma versão 2 de cadeia pesada ("LV2"), em que a cadeia leve consiste nas substituições de aminoácidos L47W e I58V da SEQ ID NO:2. Em certas modalidades, o anticorpo humanizado compreende uma versão 3 de cadeia leve ("LV3"), em que a cadeia leve consiste na substituição de aminoácidos L47W da SEQ ID NO:1. Em certas modalidades, o anticorpo humanizado compreende uma versão 4 de cadeia leve ("LV4"), em que a cadeia leve consiste nas substituições de aminoácidos E1 Q e L47W da SEQ ID NO:2. Em certas modalidades, o anticorpo humanizado compreende uma versão 5 de cadeia leve ("LV5"), em que a cadeia leve consiste em SEQ ID NO:1.
Em certas modalidades, o anticorpo humanizado compreende um domínio variável de cadeia pesada e leve que compreende HV3, em que a cadeia pesada consiste em SEQ ID NO:1 e LV5, em que a cadeia leve consiste em SEQ ID NO:2.
Em certas modalidades, os anticorpos humanizados têm CDRs derivadas do anticorpo 6.3G9 (N° de Acesso ATCC PTA-3649).
Em modalidades relacionadas, a presente invenção também se refere a anticorpos monoclonais humanizados tendo especificidade de ligação para integrinas αν β. em que os anticorpos compreendem domínios variáveis de cadeias pesada e leve das SEQ ID NO:3 e SEQ ID NO:4. Tais anticorpos humanizados são derivados da humanização do anticorpo murino 8G6. Em certas modalidades, o anticorpos humanizados compreendem uma cadeia pesada, cujas regiões determinantes de complementaridade (CDR) 1 , 2 e 3 são definidas por resíduos de aminoácidos (isto é, com exceção de algumas variações conservativas) 31 -35, 50-66 e 99-115, respectivamente, da SEQ ID NO:3. Em certas modalidades, os anticorpos humanizados compreendem uma cadeia leve, cujas CDRs 1 , 2 e 3 são definidas pelos resíduos de aminoácidos 24-38, 54-60 e 93-101 , respectivamente, da SEQ ID NO:4. Em certas modalidades, os anticorpos humanizados compreendem uma cadeia pesada, cujas regiões de estrutura (FR) 1 , 2, 3 e 4 são definidas pelos resíduos de aminoácidos 1 -30, 36-49, 67-98, e 116-126, respectivamente, da SEQ ID NO:3. Em certas modalidades, os anticorpos humanizados compreendem uma cadeia leve, cujas FR 1 , 2, 3 e 4 são definidas pelos resíduos de aminoácidos 1 -23, 39-53, 61 -92 e 102-11 1 , respectivamente, da SEQ ID N0:4.
Em certas modalidades, os anticorpos humanizados compreendem pelo menos uma das seguintes substituições de aminoácidos na cadeia pesada consistindo em A24G, G26S, Q39L, M48I, V68A, R72V e T74K da SEQ ID NO:3. Em certas modalidades, os anticorpos humanizados compreendem pelo menos uma das seguintes substituições de aminoácidos na cadeia leve consistindo em E1 D, L46F e Y49K da SEQ ID NO:4.
Em certas modalidades, o anticorpo humanizado compreende uma versão 1 de cadeia pesada ("HV1 "), em que a cadeia pesada consiste nas substituições de aminoácidos A24G, G26S, Q39L, M48I, V68A, R72V e T74K da SEQ ID NO:3. Em certas modalidades, o anticorpo humanizado compreende uma versão 2 de cadeia pesada ("HV2"), em que a cadeia pesada consiste nas substituições de aminoácidos 48I, V68A, R72V e T72V da SEQ ID NO:3. Em certas modalidades, o anticorpo humanizado compreende uma versão 3 de cadeia pesada ("HV3"), em que a cadeia pesada consiste nas substituições de aminoácidos V68A, R72V e T74K da SEQ ID NO:3.
Em certas modalidades, o anticorpo humanizado compreende uma versão 1 de cadeia leve ("LV1 "), em que a cadeia leve consiste nas substituições de aminoácidos E1 D, L46F e Y49K da SEQ ID NO:4. Em certas modalidades, o anticorpo humanizado compreende uma versão 2 de cadeia leve ("LV2"), em que a cadeia leve consiste nas substituições de aminoácidos L46F e Y49K da SEQ ID NO:4. Em certas modalidades, o anticorpo humanizado compreende uma versão 3 de cadeia leve ("LV3"), em que a cadeia leve consiste na substituição de aminoácido Y49K da SEQ ID NO:4.
Em certas modalidades, os anticorpos humanizados têm CDRs derivadas do anticorpo murino 6.8G6. Em certas modalidades, os anticorpos humanizados podem competir por ligação a Ονββ com o anticorpo murino 8G6.
A presente invenção engloba também anticorpos humanizados que se ligam ao mesmo epítopo como qualquer um dos anticorpos descritos acima.

A presente invenção engloba também anticorpos humanizados produzidos por um vetor recombinante compreendendo um ácido nucléico que codificada os ditos anticorpos. Em certas modalidades, o vetor recombinante pode ser um plasmídio selecionado do grupo que consiste em pKJS195 (SEQ ID NO:5), pKJS189 (SEQ ID NO:6) e pKJS196 (SEQ ID NO:7).
A presente invenção engloba também ácidos nucléicos isolados compreendendo uma sequência de codificação para qualquer uma das SEQ ID NOs:1 -7 e polipeptídeos isolados compreendendo uma sequência de a- minoácidos de qualquer uma das SEQ ID NOs: 1 -7.
A presente invenção engloba também vetores recombinantes compreendendo os ácidos nucléicos de qualquer um dos anticorpos humanizados descritos acima.
A presente invenção engloba também células hospedeiras compreendendo os vetores recombinantes que compreendem os ácidos nucléicos de qualquer um dos anticorpos humanizados descritos acima.
Esta invenção engloba também composições que compreendem um ou mais anticorpos humanizados desta invenção e um veículo farmaceu-ticamente aceitável. Em algumas dessas composições, os anticorpos humanizados são conjugados a um agente citotóxico (isto é um agente citotóxico que deteriora a viabilidade e/ou as funções de uma célula), tal como uma toxina ou um radionuclídeo. A composição pode ser administrada a um paciente (por exemplo, um mamífero tal como um ser humano) tendo ou em risco de ter uma doença mediada por Ονββ, de modo a tratar (por exemplo, aliviar, mitigar, reduzir, prevenir, postergar o início de) a doença. Exemplos de tais doenças incluem, mas sem limitação: fibrose (por exemplo, escleroder-mia, formação de cicatriz, fibrose hepática, fibrose pulmonar, e fibrose renal); psoríase; câncer (conforme descrito em outro lugar aqui, por exemplo, câncer epitelial; câncer oral, da pele, cervical, ovariano, faríngeo, laríngeo, esofágico, do pulmão, da mama, do rim, pancreático, prostático ou colorretal); síndrome de Alport; lesões agudas e crónicas do pulmão, fígado, rim e outros órgãos internos; e esclerose do pulmão, fígado, rim e outros órgãos in- ternos. Riscos de ter tais doenças podem resultar de predisposição genética; certos estilos de vida, tais como tabagismo e alcoolismo; exposição a poluentes ambientais, tais como asbestos; condições fisiológicas, tais como, diabetes, infecção com o vírus da hepatite (por exemplo, infecção com o vírus da hepatite C), doenças auto-imunes; e tratamentos médicos, tal como terapia de radiação.
A presente invenção engloba também métodos para preparar qualquer um dos anticorpos humanizados citados acima por cultura de qualquer uma das células hospedeiras mencionadas acima, sob condições apropriadas, para expressão do anticorpo humanizado, em que as. cadeias do anticorpo humanizado são expressas e os anticorpos humanizados são produzidos. Em certas modalidades, os métodos ainda compreendem as etapas de isolar os anticorpos humanizados. Em certas modalidades, a célula hospedeira é uma célula CHO.
Os clones dos hibridomas 6.3G9 e 6.8G6 foram depositados em 16 de agosto de 2001 , no American Type Culture Collection ("ATCC"; P.O. Box 1549, Manassas, VA 20108, E.U.A.) sob o Tratado de Budapeste, e têm os números de acesso ATCC PTA-3649 e -3645, respectivamente.
Um anticorpo humanizado da presente invenção refere-se a um anticorpo inteiro, por exemplo, um anticorpo compreendendo duas cadeias pesadas e duas cadeias leves, ou a um fragmento de ligação de antígeno de um anticorpo inteiro, tais como um fragmento Fab, um fragmento Fab', um fragmento F(ab')2 ou um fragmento F(v). Um anticorpo humanizado desta invenção pode ser de qualquer isótipo e subtipo, por exemplo, IgA (por exemplo, lgA1 e Ig A2), IgG (por exemplo, lgG1 , lgG2, lgG3 e lgG4), IgE, IgD, IgM, em que as cadeias leves da imunoglobulina podem ser do tipo kappa ou lambda.
Em algumas modalidades, o anticorpo humanizado da presente invenção pode compreender uma mutação (por exemplo, deleção, substituição ou adição), em uma ou mais (por exemplo, 2, 3, 4, 5, ou 6) de certas posições na cadeia pesada de modo que a função efetora do anticorpo (por exemplo, a capacidade do anticorpo de se ligar ao receptor Fc ou a um fator de complemento) é alterada sem afetar a capacidade de ligação de antígeno do anticorpo.
Em outras modalidades, o anticorpo humanizado desta invenção pode conter uma mutação em um resíduo de aminoácidos que é um sítio para glicosilação, de modo que o sítio de glicosilação é eliminado. Tal anticorpo humanizado pode ter funções efetoras clinicamente benéficas reduzidas, ou outras funções indesejadas, enquanto a sua afinidade de ligação de antígeno é retida. Mutação de um sítio de glicosilação pode ser também benéfica para desenvolvimento de processo (por exemplo, expressão e purificação de proteína).
Em certas modalidades desta invenção, o anticorpo humanizado compreende uma cadeia leve de aglicosila cujas CDRs são derivadas do anticorpo murino 3G9. Em certas modalidades, o anticorpo 3G9 humanizado contém um domínio variável de cadeia leve, em que a região CDR1 contém uma substituição de asparagina (N) para serina (S) no resíduo de aminoácido 26 da SEQ ID NO:2. A região CDR1 de 3G9 murino contém uma asparagina em suma posição de aminoácido. Contudo, a versão humanizada do anticorpo 3G9, todas as cinco versões da cadeia leve (LV1 , LV2, LV3, LV4 e LV5), contém serina dentro da região CDR1 de 3G9 nesta posição, Aglicosilação desse sítio em todas as versões da cadeia leve do anticorpo 3G9 humanizado tem mostrado ser benéfica tanto para a expressão da proteína como purificação das cadeias leves. Em outras certas modalidades, o anticorpo 3G9 humanizado contém uma mutação em um sítio de glicosilação que é normalmente requerida para ligação de receptor de Fc normal. Em certas modalidades, o anticorpo 3G9. humanizado contém uma substituição de aminoácidos de asparagina (N) para glutamina (Q). Em certas modalidades, o anticorpo 3G9 humanizado contém a substituição de aminoácidos de N para Q na versão 3 de cadeia pesada (HV3) produzida por um vetor re-combinante que compreende o plasmídio pKJS196 (SEQ ID NO:7). Em certas modalidades, a substituição de aminoácidos de N para Q ocorre no resíduo de aminoácido 319 da SEQ ID NO:7. Aglicosilação desse sítio na versão 3 de cadeia pesada (HV3) do anticorpo 3G9 humanizado tem mostrado que remove um sinal de glicosilação requerido para ligação de receptor de Fc normal sem afetar a afinidade de ligação de antígeno do anticorpo humanizado. Em certas modalidades, o anticorpo 3G9 humanizado compreende a versão 3 de cadeia pesada (HV3) produzida por um vetor recombinante que compreende o plasmídio pKJS189 (SEQ ID NO:6) e a versão 5 de cadeia leve (LV5) produzida por um vetor recombinante compreendendo o plasmídio pKJS195 (SEQ ID NO:5). Em certas modalidades, o anticorpo 3G9 humanizado compreende a versão 3 de cadeia pesada de aglicosila (a-HV3) produzida por um vetor recombinante que compreende o plasmídio pKJS196 (SEQ ID NO:7) e a versão 5 de cadeia leve (LV5) produzida por um vetor recombinante que compreende o plasmídio pKJS195 (SEQ ID NO:5).
Em ainda outras modalidades, as cadeias pesadas ou leves podem conter mutações que aumentam a afinidade ou potência.
Os anticorpos humanizados da invenção são úteis para tratar qualquer condição clinicamente indesejável ou doença (conforme discutido aqui) que seja mediada por ligação de ονββ a seu ligante, tal como LAP e fibronectina. Esses anticorpos humanizados podem ser mais potentes, por meio de maior afinidade ou avidez, e dependência de cátion ou independência de ligação ao ligante, que os anticorpos ανββ previamente conhecidos. Em contraste aos anticorpos monoclonais murinos, os anticorpos humanizados desta invenção não causarão a produção de anticorpos de imunoglobu- -lina anticamundongo no paciente, especialmente no corpo humano, mas em vez disso mostram uma prolongada meia-vida no sangue, com uma frequência reduzida de efeitos colaterais, de modo que pode se esperar que sejam superiores aos anticorpos monoclonais de camundongo na eficácia de tratamento de doenças mediadas por ανββ- Em aspectos adicionais, a presente invenção refere-se a métodos para diagnóstico, tratamento e prevenção de câncer usando ligantes de ligação ανβ6, tais como anticorpos de ligação ανβε· Em uma modalidade, a presente invenção proporciona métodos para reduzir ou prevenir a metásta-se de um local do tumor primário para um local secundário em um paciente, que compreende administrar ao paciente uma quantidade terapeuticamente eficaz de um ou mais ligantes que se ligam a uma ou mais subunidades de integrina Ονββ sobre uma ou mais células no tumor primário, em que a ligação do ligante à integrina resulta na morte, quimiossensibilidade ou invasivi- dade reduzida da célula tumoral. Em modalidades relacionadas, a invenção proporciona métodos para reduzir ou prevenir a progressão do tumor pré- metastático para um tumor metastático em um paciente, que compreende administrar ao paciente uma quantidade terapeuticamenté eficaz de um ou mais ligantes que se ligam a uma ou mais subunidades de integrina ανβ6 sobre uma ou mais células no tumor pré-metastático, em que a ligação do ligante à integrina resulta na redução ou prevenção de invasão de células do câncer pré-metastático em áreas teciduais que circundam o tumor primário. Em certas de tais modalidades da invenção, a célula tumoral é um carcinoma, tal como um adenocarcinoma. Em modalidades mais particulares, o carcinoma é um carcinoma da mama, um carcinoma do endométrio, um carcinoma pancreático, um carcinoma colorretal, um carcinoma do pulmão, um carcinoma ovariano, um carcinoma cervical, um carcinoma prostático, um carcinoma do fígado, um carcinoma esofágico, um carcinoma da cabeça ou do pescoço, um carcinoma do estômago ou um carcinoma esplénico. Mais particularmente, o carcinoma é um carcinoma da mama (incluindo, mas sem limitação, um carcinoma da mama in situ, tal como carcinoma ductal in situ (DCIS) ou carcinoma lobular in situ (LCIS), um carcinoma do endométrio, um carcinoma pancreático, um carcinoma colorretal, um carcinoma cervical, ou um carcinoma do pulmão.
Modalidades adequadas de acordo com esse aspecto da invenção usam ligantes de ligação de integrina ο βθ, que são anticorpos de ligação de Ονββ ou fragmentos de ligação de epítopo ανββ. De acordo com certas de tais modalidades, os anticorpos são anticorpos monoclonais (que podem ser quiméricos, primatizados ou humanizados), incluindo aqueles descritos na publicação de Pedido de Patente US 2005/0255102 A1 , cuja exposição é aqui incorporada a título de referência em sua totalidade. Tais anticorpos adequados incluem, mas sem limitação, anticorpos monoclonais de ligação de θνβ6 designados por 1A8, 3G9, 8G6, 2B1 , 2B10, 2A1 , 2E5, 1G10, 1 C5, 10D5 (depósito ATCC N° HN 12382) e CS 6, bem como fragmentos, quimeras e híbridos destes. Particularmente adequados para uso em tais modalidades da invenção são anticorpos monoclonais 3G9 e 8G6. Também particularmente adequados para uso em tais modalidades da invenção são anticorpos monoclonais humanizados, tais como o anticorpo 3G9 humanizado designado como hu3G9 (BG0001 1 ) e o anticorpo 8G6 humanizado designado como hu8G6.
Em certas de tais modalidades terapêuticas da invenção, os ligantes de ligação de ανββ (por exemplo, anticorpo de ligação de ανββ) são conjugados com ou ligados a um ou mais compostos citotóxicos ou agentes que levam a ou causam a morte da célula ou do tecido mediante ligação do conjugado de ligante de ligação de
tóxico a uma ou mais in-tegrinas ανββ sobre a célula ou tecido. Em certas modalidades terapêuticas adicionais da invenção, os ligantes de ligação de ανββ (por exemplo, anticorpos de ligação de Ονβε) são administrados a um paciente em conjunto com um ou mais de tais compostos tóxicos ou agentes. Os compostos ou agentes citotóxicos, que podem ser adequadamente usados de acordo com esses aspectos da invenção, incluem, mas sem limitação, agentes citotóxicos, (por exemplo, cisplatina, carboplatina, oxaliplatina, paclitaxel, melfalano, do-xorrubicina, metotrexato, 5-fluoruracila, etoposídeo, meclorretamina, ciclofos-famida, bleomicina, caliqueamicina, maitansina, tricoteno, CC1065, cadeia A da difteria, cadeia A da exotoxina de Pseudomonas aeruginosa, cadeia A da ricina, cadeia A da abrina, cadeia A da modecina, alfa-sarcina, uma proteína de Aleuritesfordii, proteínas diantina, proteína de Phytolaca americana, inibidor de Mormodica charantia, curcina, crotina, inibidor de Sapaonaria officina-lis, gelonina, mitogelina, restrictocina, fenomicina, enomicina, tricotecenos, ribonucleases, e desorribonucleases), radioisótopos (tais como 211At, 13 l, 125l, 90Y, 186Re, 88Re, 153Sm, 212Bi, 32P e isótopos radioativos de Lu) e enzimas ativadores de pró-fármaco (tais como fosfatase alcalina, arilsulfatase, citosina desaminase, proteases, D-alanilcarbóxi-peptidases, enzimas de clivagem de carboidrato, P-lactamase e penicilina amidase. Em certas modalidades, o um ou mais ligantes de ligação de integrina ανβ6 administrados ao paciente na forma de uma composição farmacêutica que compreende uma quantidade eficaz de um ou mais dos ligantes de ligação de integrina Ονβε e um ou mais veículos ou excipientes farmaceuticamente aceitáveis. O um ou mais ligantes de ligação de integrina ανββ e/ou uma ou mais composições farmacêuticas compreendendo o um ou mais ligantes de integrina θνβ6 podem ser administrados ao paciente por qualquer modo adequado de administrar composições farmacêuticas, incluindo, mas sem limitação, administração oral, administração parenteral (incluindo, por exemplo, injeção através da por meio de intramuscular, intravenosa, intra-arterial, intraperitoneal, ou subcutânea), administração intracraniana, administração, transdérmica, administração intrapulmonar e administração intranasal.
Em modalidades adicionais, a presente invenção proporciona métodos para diagnosticar ou identificar um carcinoma, tal como um adeno- carcinoma, que é mais provável de progredir para um carcinoma invasivo, e/ou que seja mais provável de responder ao tratamento com um ligante que se liga a uma ou mais subunidades de integrina Ονββ- Tais métodos adequados podem compreender, por exemplo, (a) obter de um paciente uma amostra de tecido epitelial canceroso compreendendo um tumor ou uma porção deste, e uma amostra de tecido epitelial não canceroso; (b) contatar as a-mostras de tecido com um ou mais ligantes que se ligam a uma ou mais subunidades de integrina θνβ6; e (c) determinar o nível de expressão da integrina ( νββ nas amostras de tecido, em que um aumento no nível de expressão de integrina Ονββ na amostra de tecido canceroso com relação ao nível de expressão de integrina θνβ6 na amostra de tecido não canceroso indica a presença no paciente de um carcinoma que: (a) tem uma probabilidade aumentada de progredir de uma forma in situ ou não invasiva, a uma forma metastática invasiva; e/ou (b) é mais provável de responder ao tratamento com um ou mais dos métodos de tratamento referenciados acima, que se baseiam na ligação de um ligante de ligação de ανβ particularmente um ligante de ligação de ανββ que é conjugado a ou que é administrado em conjunto com um ou mais compostos ou agentes citotoxicos, tais como aqueles descritos acima. Tais métodos são adequados para diagnosticar ou identifi- car uma variedade de carcinomas, incluindo, mas sem limitação, aqueles envolvendo os tecidos epiteliais citados acima. Em certas de tais modalidades, o ligante que se liga a uma ou mais subunidades de integrina θνββ é uma anticorpo de ligação de integrina ανββ (que pode ser um anticorpo mo- noclonal tal como aqueles descritos acima) ou um fragmento de ligação de epítopo Ονββ deste. Particularmente adequados para uso em tais métodos de diagnóstico da invenção são ligantes de ligação de ανββ (por exemplo, anticorpos) que são detectavelmente marcados, isto é, que compreendem, são conjugados a, ou são ligados com pelo menos um rótulo detectável, tais como um rótulo cromogênico (por exemplo, diaminobenzidina ou ácido 4-hidroxiazobenzeno-2-carboxílico), um rótulo de enzima (por exemplo, malato desidrogenase, estafilococo nuclease, delta-5-esteróide isomerase, álcool de levedura desidrogenase, fosfato de alfa-glicerol desidrogenase, triose fosfato isomerase, peroxidase, fosfatase alcalina, asparaginase, glicose oxidase, β-galactosidase, ribonuclease, urease, cataiase, glicose-6-fosfato desidrogenase, glicoamilase ou acetilcolina esterase), um rótulo radioisotópico (por exemplo, 3H, 111ln, 25l, 31l, 32Ρ· ^S, 4C, 5 Cr, 57To, 58Co, 59Fe, 75Se, 152Eu, 90Y, 67Cu, 217Ci, 211 At, 212Pb, 47Sc, e 109Pd), um rótulo isotópico não radiativo (por exemplo, 157Gd, 55Mn, 6 Dy, 52Tr, 56Fe, 99mTe e 112ln), um rótulo fluorescente (por exemplo, um rótulo 152Eu, um rótulo de fluoresceína, um rótulo de isotiocianato, um rótulo de rodamina, um rótulo de ficoeritrina, um rótulo de ficocianina, um rótulo aloficocianina, um rótulo de Proteína Fluorescente Verde (GFP), um rótulo de o-ftaldeído ou um rótulo de fluorescamina), um rótulo tóxico (por exemplo, um rótulo da toxina da difteria, um rótulo de ricina e um rótulo da toxina da cólera), um rótulo quimioluminescente (por exemplo, um rótulo de luminol, rótulo de isoluminol, rótulo de éster de acridínio aromático, rótulo de imidazol, rótulo de sal de acridínio, rótulo de éster de oxalato, rótulo de luciferina, rótulo de luciferase e rótulo de aequorina.um rótulo X- radiográfico (por exemplo, bário ou césio), um rótulo de spin (por exemplo, deutério) e um rótulo de agente de contraste de ressonância magnética nuclear (por exemplo, Gd, Mn e ferro).
Em modalidades adicionais, a invenção proporciona métodos para eliminar células tumorais metastáticas positivas para Ονββ em um paciente, compreendendo administrar ao paciente uma quantidade terapeutica- mente eficaz de um ou mais ligantes que se ligam a uma ou mais subunidades de integrina ανββ sobre uma ou mais células tumorais metastáticas positivas para ανββ, em que a ligação do ligante à integrina resulta na morte, quimiossensibilização ou invasividade diminuída da célula tumoral metastáti- ca. Tais métodos são adequados para eliminar uma variedade de células tumorais metastáticas em um paciente, tais como aquelas produzidas de carcinomas metastáticos, incluindo, mas sem limitação, aquelas que envolvem tecidos os epiteliais citados acima. Modalidades adequadas de acordo com esse aspecto da invenção usam ligantes de ligação de integrina ανββ, que são anticorpos de ligação de ανβε ou seus fragmentos de ligação de epí-topo Ονβε, particularmente os anticorpos monoclonais, ou variantes ou fragmentos destes, descritos acima. Em certas modalidades terapêuticas da invenção, os ligantes de ligação de Ονββ (por exemplo, anticorpos de ligação de Ονββ) são conjugados com ou ligados a um ou mais compostos ou agentes citotóxicos que levam a, ou causam, a morte da célula ou tecido mediante ligação do conjugado de ligante de ligação de a^6-composto tóxico a uma ou mais integrinas θνβ6 sobre a célula ou tecido. Em modalidades terapêuticas adicionais da invenção, os ligantes de ligação de ο βδ (por exemplo, anticorpos de ligação de ανβε) são administrados a um paciente em conjunto com um ou mais compostos ou agentes citotóxicos. Os compostos ou agentes citotóxicos que podem ser adequadamente usados de acordo com esses aspectos da invenção incluem, mas sem limitação, os agentes citotóxicos, radioisótopos e enzimas ativadoras de pró-fármaco descritos acima. De a-cordo com esse aspecto da invenção, o ligante de ligação de integrina ο ββ, ou uma composição farmacêutica compreendendo o ligante e um ou mais veículos ou excipientes farmacêuticos, pode ser administrada ao paciente de acordo com os modos de administração descritos acima.
Em modalidades adicionais, a invenção proporciona métodos para eliminar células tumorais positivas para ο ββ, residuais, de um paciente seguinte à excisão cirúrgica de um tumor de um tecido ou órgão do paciente, compreendendo administrar ao paciente uma quantidade terapeuticamente eficaz de um ou mais ligantes que se ligam a uma ou mais subunidades de integrina ο ββ sobre uma ou mais células tumorais residuais no tecido ou órgão, em que a ligação do ligante à dita integrina resulta na morte, quimios- sensibilidade ou invasividade diminuída da célula tumoral. Tais métodos são adequados para eliminar uma variedade de células tumorais metastáticas em uma variedade de tecidos do paciente, tais como aquelas produzidas de carcinomas, incluindo, mas sem limitação, aquelas envolvendo os tecidos epiteliais citados acima. Modalidades adequadas de acordo com esse as-peçto da invenção usam ligantes de ligação de integrina Ονβε, que são anticorpos de ligação de Ονββ ou fragmentos de ligação de epítopo Ονββ destes, particularmente os anticorpos monoclonais, ou variantes ou fragmentos destes, descritos acima. Em certas de tais modalidades terapêuticas da invenção, os ligantes de ligação de νββ (por exemplo, anticorpos de ligação de Ονββ) são conjugados com ou ligados a um ou mais compostos ou agentes citotóxicos que levam a, ou causam a morte da célula ou tecido mediante ligação do conjugado de ligante de ligação de a^6-composto tóxico a uma ou mais integrinas ο βε sobre a célula ou tecido. Os compostos ou agentes citotóxicos, que podem ser adequadamente usados de acordo com este as-pecto da invenção incluem, mas sem limitação, os agentes citotóxicos, radioisótopos e enzimas ativadoras de pró-fármaco descritas acima.
Outras modalidades preferidas da presente invenção tornar-se-ão aparentes para aquele com conhecimento ordinário à luz dos seguintes desenhos e descrição da invenção, e das reivindicações.
Breve Descrição dos Desenhos
A figura 1 é um ensaio ELISA de ligação de variantes de 3G9 quimerizadas, purificadas para Ονβε. As placas revestidas com θνβ6 solúvel foram incubadas com ou hibridoma purificado derivado do anticorpo 3G9 murino, anticorpo 3G9 quimérico purificado (m3G9) (ch3G9), ou anticorpo 3G9 quimérico, purificado, contendo uma substituição de N para S dentro do sítio de glicosilação ligado a N na primeira CDR da cadeia leve (ch3G9S). Depois de lavar com tampão de lavagem, as placas foram incubadas com IgG anticamundongo conjugado com peróxido (para o material derivado de hibridoma) ou IgG antihumano (para os anticorpos quiméricos) seguido por lavagem com tampão de lavagem. As placas foram relveladas com solução de TMB, as reações foram interrompidas com ácido sulfúrico e ensaiadas com um leitor de placa em A 50. Não houve diferença significante detectável entre as duas formas de anticorpo 3G9 quimérico.
A figura 2 exibe os resultados mostrando a expressão de variantes humanizadas de 3G9 de células 293E transfectadas usando o Ensaio Easy Titer (Pierce). Os sobrenadantes das células 293E transitoriamente transfectadas foram ensaiadas para título de anticorpo pelo método Easy Titer seguindo o protocolo do fabricante (Pierce). A expressão de diferentes variantes do anticorpo 3G9 humanizado foi analisada. As variantes de 3G9 contendo a versão 1 da cadeia leve são pobremente expressas, enquanto as variantes contendo a versão 2 da cadeia leve são expressas em altos níveis. Há uma tendência à expressão maior com humanização crescente.
A figura 3 mostra os resultados da análise de FACS das variantes do anticorpo hu-3G9 se ligando às células SW480 que expressam inte-grina Ονββ conforme determinação por ensaio de citometria de fluxo. Células SW480 foram colhidas por tripsinização, lavadas e ressuspensas em tampão de FACS. 2 x 105 células foram então incubadas sobre gelo por 1 hora em tampão de FACS contendo o sobrenadante transfectante, os títulos do qual foram determinados pelo métodos Easy Titer de acordo com o protocolo do fabricante (Pierce). Depois da incubação, as células foram lavadas com tampão de FACS e ressuspensas em tampão de FACS contendo IgG antihumano conjugado com ficoeritrina (Jackson ImmunoResearch) e incubadas em gelo por 30 minutos. As células foram então lavadas e ressuspensas em 200 μL· de tampão de FACS. A ligação do anticorpo secundário marcado foi monitorada por citometria de fluxo. Todas as versões humanizadas testadas se ligaram às células SW480 pelo menos tão bem quanto 3G9 quimérico. Variantes contendo a versão 2 da cadeia leve excederam significantemente a atividade do 3G9 quimérico. O anticorpo Hu-BHA10 do receptor de anti-linfotoxina-beta serviu como controle negativo.

A figura 4 mostra a análise de FACS das versões 2-5 do anticorpo hu-3G9 que se ligam às células FDCPI -βθ. A análise de FACS foi efetu- ada como descrito na figura 3 exceto que as células FDCPI-βθ foram usadas no lugar das células SW480. A versão 5 da variante inteiramente humanizada (H3/L5) se ligou melhor a FDCPI -βθ que outras versões de humanização.
A figura 5 exibe a análise de FACS das versões 2-5 do anticorpo hu-3G9 se ligando às células FDCPI -ββ. A análise de FACS foi efetuada conforme descrita na figura 4, usando variantes de humanização de 3G9 purificado. A versão 5 de variante inteiramente humanizada (H3/L5) se ligou significantemente melhor à FDCPI -βθ que todas as outras versões humanizadas.
A figura 6 é um ensaio ELISA de ligação das versões 2-5 do anticorpo hu-3G9 purificado se ligando a ανββ· O ELISA de ligação foi efetuado conforme descrito na figura 1. A versão 5 de 3G9 humanizada (H3/L5) parece se ligar a ανββ de modo ligeiramente melhor que os outros derivados do anticorpo.
A figura 7 é um ELISA de bloqueio das versões 2-5 do anticorpo hu-3G9 purificadas se ligando a Ονβ. Placas foram revestidas com ou 0,3 μg/mL de LAP ou 2,5 μg da proteína de fusão LAP-Fc e incubadas a 4°C, durante a noite. -A solução de -revestimento foi removida e as placas foram bloqueadas, lavadas, e incubadas com uma mistura de Ονββ biotinilado e os derivados de 3G9 conforme indicação na legenda da figura, em presença de cálcio e magnésio. A placa foi lavada novamente e incubada com conjugado de extravidina-raiz forte peroxidase (Sigma). Proteína ligada foi detectada usando-se substrato de TMB seguido por detecção em um leitor de placa a A450. A versão 5 de 3G9 humanizado (H3/L5) parece bloquear a ligação de θνββ ao LAP de modo ligeiramente melhor que outros derivados do anticorpo.
A figura 8 exibe os resultados de um ensaio de adesão celular das versões 2-5 do anticorpo hu-3G9. Placas de microtítulo foram revestidas com 50 μΙ_/ιτιί de LAP, a 4°C, durante a noite. As placas foram então lavadas e bloqueadas. Células FDCPI-ββ (5 x 106 células/mL) foram retiradas dos frascos de cultura, marcadas com corante fluorescente (Calce ína-AM, Molecular Probes, Eugene, OR) e ressuspensas em um tampão de ensaio. As placas foram incubadas com os anticorpos purificados indicados acima, e as células FDCPI-ββ marcadas em presença de cálcio e magnésio. A placa foi lavada e a fluorescência devida às células capturadas na placa fora registradas. O percentual de ligação foi determinado por comparação da fluorescência das células totais com aquela das células ligadas. A versão 5 de 3G9 humanizado (H3/L5) parece bloquear a ligação de células que expressam θνβ6 ao LAP ligeiramente melhor que outros derivados do anticorpo.
A figura 9 é uma representação esquemática do mapa de plas- mídio pKJS195 e a sequência de cadeia leve da versão 5 de 3G9. Esse plasmídio contém a cadeia leve da versão 5 (LV5) de 3G9 e os genes de resistência à neomicina. O cassete de expressão de cadeia leve contém o promotor precoce imediato de CMV humano e o primeiro intron (contendo uma deleção pequena), bem como a sequência de poliadenilação de hormô- nio de crescimento humano.
A figura 10 é uma representação esquemática do mapa de o plasmídio pKJS195 e a sequência de cadeia pesada da versão 3 de 3G9. Esse plasmídio contém a cadeia pesada da versão 3 (HV3) de 3G9 e genes de desidrofolato redutase (dhfr). O cassete de expressão de cadeia pesada - contém o promotor precoce imediato de CMV humano e primeiro intron (contendo uma pequena deleção), bem como a sequência de poliadenilação de hormônio de crescimento humano. O cassete de expressão de dhfr contém o promotor precoce de SV40 e sequência de poliadenilação de SV40.
A figura 11 é uma representação esquemática do mapa de o plasmídio pKJS196 e a sequência de cadeia pesada da versão 3 de aglicosi- la-3G9. Esse plasmídio contém a cadeia pesada de versão 3 de aglicosila- 3G9 (a-HV3) e genes dhfr. Essa construção é idêntica a pKJS189 exceto por uma substituição de N319Q que abole um sítio de glicosilação ligado a N na região constante da cadeia pesada.
A figura 12 mostra os resultados da montagem e expressão de hu-3G9 CHO transitoriamente transfectados em células CHO usando o En- saio Easy Titer (Pierce). O ensaio Easy Titer foi efetuado como descrito na figura 2 de acordo com o protocolo do fabricante (Pierce). Vetores da versão 5 do 3G9 do tipo selvagem (H3/L5) e aglicosila-humanizado (a-H3-L5) foram transitoriamente transfectados em células CHO para demonstrar a montagem eficaz e secreção do 3G9 humanizado dessas células. Ambas as formas de anticorpos hu3G9 são igualmente montadas e expressas em células CHO.
A figura 13 é um compósito de fotomicrografias mostrando os níveis de expressão de ανββ (áreas escuras) em certos carcinomas humanos que metastatizaram para o linfonodo (figuras 13A-3D) ou para o pulmão (figuras 13E-13F), dos sítios tumorais primários indicados.
A figura 14 é um compósito de fotomicrografias mostrando os níveis de expressão de ανβ6 (áreas escuras) em certos carcinomas humanos que metastatizaram do sítio tumoral primário indicado para o sítio tumoral metastático indicado.
A figura 15 é um compósito de fotomicrografias mostrando os níveis de expressão de Ονββ (áreas escuras) observados nos tumores de carcinoma do endométrio, primários (figuras 15A, 15C), e em metástases de linfonodos emparelhados (figuras 15B, 15D).
A figura 16 é um compósito de fotomicrografias mostrando os níveis de expressão de θνβ6 (áreas escuras) observados em amostras de tumor da mama humano. Figura 16A: expressão em amostra de tumor primário de paciente com carcinoma ductal in situ (DCIS). figura 16B: expressão em amostra de tumor primário de paciente com carcinoma da mama invasivo.
A figura 17 é um compósito de fotomicrografias mostrando os níveis de expressão de ανβε (áreas escuras) observados em amostras emparelhadas de tumores de adenocarcinoma ductal pancreático, primários e metastáticos, de três pacientes diferentes, figuras 17A-17C: expressão em amostras de tumor primário de três pacientes diferentes. As figuras 17D-17F: expressão em metástases de linfonodos emparelhados desses mesmos três pacientes, figuras 17G-17H: expressão em tecido pancreático normal obtido de dois dos três pacientes.
A figura 18 é um compósito de fotomicrografias mostrando os níveis de expressão de ο βε (áreas escuras) observados em amostradas emparelhadas de tumores de adenocarcinoma pancreático, primários e me- tastáticos, de cinco pacientes diferentes, figuras 18A-18E: expressão em amostras de tumor primário de cinco pacientes diferentes, três com tumores caracterizados como adenoescamosos (figuras 18A-18C), e dois com tumores caracterizados como fracamente diferenciados (figuras 18D-18E). figuras 18F-18J: expressão em metástases de linfonodos emparelhados desses mesmo cinco pacientes, figuras 18K-18L: expressão em tecido pancreático-normal, obtida de dois dos cinco pacientes.
A figura 19 demonstra a capacidade de um anticorpo monoclonal anti-otvP6 (3G9) em inibir o crescimento de tumor no modelo de xenoenxerto de camundongo BxPC-3 de câncer pancreático humano. Figura 19A: fotomi-crografia de uma seção do tumor de xenoenxerto colorido por meio de imu-noistoquímica com um anticorpo monoclonal anti-otv 6 (3G9). Figura 19B: curvas de crescimento do tumor de xenoenxerto BxPC-3 durante o tratamento com θνβ6 mAB 3G9 (A ), proteína de fusão TGFbRII-Fc-lg ( ▼ ), ou veículo de PBS (■). Figura 19C: plotagem de dispersão dos tamanhos de tumores individuais no fim do estudo (dia 66).
Figura 20 é uma série de gráficos em barras demonstrando os efeitos de um anticorpo monoclonal anti-o^6 (3G9), e de um conjugado solúvel de receptor de TGF^-fragmento de anticorpo (sTGF^RII-Fc), sobre migração de transmatriz, invasão e produção da metaloproteinase 9 da matriz (MMP9) por células VB6 expressando β6 (transfectadas com β6) e células transfectadas mock. Figuras 20A e 20B: migração (figura 20A) ou invasão (figura 20B) de células através da matriz celular. "Unt": células não tratadas; "3G9": células tratadas com 10 μg/mL de anticorpo monoclonal anti-oc^6 3G9; "sTGFbR-Fc": células tratadas com 10 μg/mL de conjugado solúvel de TGF^RII-Fc. Barras abertas: células transfectadas com e expressando inte-grina ββ (células VB6); barras fechadas: células transfectadas mock não expressando integrina β6 (células C1 ). Figura 20C: produção de MMP9 (ng/mL) por células C1 ou VB6 que eram não tratadas (barras abertas), tratadas com 10 μg/mL de 3G9 (barras hachuradas) ou tratadas com 10 g/mL do conjugado de sTGF- RII-Fc (barras fechadas).
A figura 21 é uma fotomicrografia de uma seção imunoistoquími- ca demonstrando a expressão de Ονββ (áreas escuras) em células tumorais invadindo o estroma em um modelo de xenoenxerto de LIM1863. Coloração com queratina anti-humana sobre diversas seções (não mostradas) confirmou que essas células eram derivadas de tumor (isto é LIM1863) epitelial humano.
As figuras 22A-22F mostram os efeitos de ανββ mAb 3G9 e proteína de fusão, solúvel, recombinante TGFbRII-Fc-lg no crescimento de tumor e invasão estromal no modelo de tumor de xenoenxerto LIM1863. Figura 22: curvas de crescimento de tumor de xenoenxerto LIM1863 durante o tratamento com ανβ6 mAB 3G9 ( A ), proteína de fusão TGFvRII-Fc-lg solúvel (T), ou veículo de PBS (■). Figura 22CB: plotagem de dispersão dos tamanhos de tumores individuais no fim do estudo (dia 52). Figura 22C: quantificação de áreas positivas para ανββ através das seções do tumor inteiro. Figuras 22D-22F: fotomicrografias mostrando a coloração representativa de ανβ6 tumores colhidos de cada grupo de tratamento indicado.
Figuras 23A-23D são histogramas de análises classificadoras de células ativadas com fluorescência (FACS) de várias linhagens de células tratadas com 3G9 mAB murino ou um mAb de controle, e demonstrando o nível de ligação de m3G9 a linhagens de células NHP expressando θνββ (A, Vero; B, LLC-MK2; C, 12MBr6; D, 4MBr5).
As figuras 24A-24B são curvas de titulação demonstrando o nível de ligação de 3G9 murino às linhagens de células NHP expressando θνβ6; B. 4MBr5).
A figura 25 é um gráfico de barras demonstrando a adesão das linhagens de células NHP que expressam θνβ6 ao LAP (A, 12MBr6; B 4MBr5).
As figuras 26A-26B são curvas de titulação demonstrando a inibição por m3G9 de adesão de linhagens de células NHP expressando θνβε ao LAP (A, 12MBr6; B, 4MBr5).

A figura 27 é um gráfico de barras demonstrando a ativação de TGF latente por linhas de células humanas e primatas expressando Ονββ- A figura 28 é uma curva demonstrando a inibição da ativação de TGF por m3G9 sobre linhagens de células SW480 6 e 4MBr5.
A figura 29 é uma série de fotomicrografias demonstrando a i- munocoloração de ανββ em doença renal humana. (A) Seções de rim humano congelado imunocoloridas com um ανββ mAb (vermelho) e uma mAb de pan-citoqueratina (verde). (B) Seções de rim humano embutidas em parafina imunocoloridas com um ανβ mAb.
A figura 30 demonstra a imunocoloração de νββ de rins de camundongos Col4A3 +/- e Col4A3 -/-. Figura 30A: fotomicrografia de seções de rim congeladas secas de de camundongos ColA4A3 +/- com 7 semanas de idade e camundongos Col4A3 -/- imunocoloridas com um θνβ6 mAb (vermelho) e um mAb de pan-citoqueratina (verde). Figura 30B: Seções de rim embutidas em parafina de camundongos Col4A3 +/- e Col4A3 -/-, com 4 e 8 semanas de idade, imunocoloridas com um θνβ6 mAb. Figura 30C: gráfico de barras demonstrando a quantificação de imunocoloração de ανββ em rins de camundongos Col4A3 +/- e Col4A3 -/- com 4, 7 e 8 semanas de idade (n=3).
A figura 31 demonstra a especificidade da ligação de ανββ mAb. Figura 31 A: Análise de citometria de fluxo de θνβ6 mAbs (3G9, 8G6, 8B3), mAb anti-αν (RMV-7), mAbs de controle negativo (1 E6 e MOPC21), e controle de isótipo (IgGI de rato) ligando às células NIH3T3 e NIH3T3b6. Figura 31 B: imunocoloração de seções de rim Col4A3 -/- e Col4A3-/-; β6-/- com mAb βηίί-ανββ (3G9 humano/quimérico). Figura 31 C: imunocoloração de seções de rim Col4A3 -/- e Col4A3-/-; β6-/- com anticorpo policlonal anti-ccv.
Figura 32 demonstra a imunocoloração de SMA em rins Col4A3 -/- com vários tratamentos. Figura 32A: imunocoloração de SMA (vermelho) e laminina (verde) em rins em mostrada para camundongos Col4A3 -/- tratados, com 3 a 8,5 semanas de idade e camundongos Col4A3+/- com idades não emparelhadas, não tratados. É mostrada a imunocoloração (córtex e medula) de uma seção representativa para cada grupo de tratamento (n = 8 para cada grupo). Figuras 32B e 32C: quantificação de SMA em rins de ca- mundongos Col4A3+/- não tratados e camundongos Col4A3-/- tratados com vários agentes de 3 a 7 semanas de idade ou de 3 a 8,5 semanas de idade. É mostrado o percentual de imunocolaração positiva para córtex (32B) e medula (32C) com relação ao tamanho total da imagem. Valor de N para cada grupo de tratamento designado na plotagem de dispersão (* - p<0,01 , ** = p<0,05, *** = p<0,001 comparando os grupos de tratamento para mAb de controle negativo, 1 E6, de controle negativo, tratados).
As figuras 33A e 33B são plotagens de dispersão representando análise Taqman de níveis de mRNA de colágeno 1a1 (figura 33A), e coláge- no 1 oc2 (figura 33B). RNA foi isolado de rins de camundongos COL4A3-/-, não tratados, ou tratados, com 7 semanas de idade, e camundongos Col4A3+/- não tratados com 7 semanas de idade.
A figura 34 é um par de plotagens de dispersão demonstrando imunocoloração por SMA de rins Col4A3-/- com tratamento retardado com mAb. Camundongos Col4A3+/-, 8,5 semanas, não tratados; Col4A3-/-, 6 semanas, não tratados; Col4A3-/- de 8,5 semanas, não tratados; e Col4A3-/- de 8,5 semanas, tratados com 1 E6 e 3G9, 6 semanas a 8,5 semanas. Os valores de N designados na plotagem de dispersão. * = p<0,006, comparando ao controle negativo 1 E6, camundongos Col4A3-/-, tratados. ** = p<0,02 comparando tratamento a camundongos Col4A3-/-, 6 semanas, não tratados.
A figura 35 mostra os Padrões de expressão gênica e modulação nos rins de camundongos Col4A3-/-, 7 semanas de idade. São mostrados 395 probesets (conjuntos de sonda molecular) da GeneChip seleciona-dos para variação de 2 vezes ou mais entre os grupos do tipo selvagem (WT) e Alport (UN), não tratados, em p<0,01. As colunas dos padrões de exibição do mapa de calor dos níveis de expressão gênica para grupos experimentais individuais. Cada coluna representa 395 valores de intensidade de sinais dos conjuntos de sonda normalizados para um único grupo experimental de cinco camundongos. Alterações na expressão gênica através das condições experimentais são refletidas na variação de cor conforme mostrado pelo Colorbar. Um clustering hierárquico bidimensional foi realizado para explorar as relações (mostradas pelo dendograma) entre os grupos experimentais.
As figuras 36A-36DD são gráficos de barras demonstrando a anotação funcional de genes dependentes de ανββ associados à doença renal em rins Gol4A3-/-. Análise de Percursos de Ingenuidade (IPA) foi realizada separadamente nas listas de conjuntos de sonda correspondentes aos genes superexpressos ou subexpressos nos rins de Alport em comparação com o tipo selvagem. As listas usadas para IPA foram subconjuntos dos 395 conjuntos de sonda originalmente selecionados quanto à variação significante (>2 vezes, p<0,01 ) entre os grupos Alport e tipo selvagem. Mostradas, em ordem de classificação, estão as listas de funções biológicas (A,C) é percursos canónicos (B,D) associados aos genes superexpressos (A,B) e infra-modu-lados (C,D) nos rins de Alport de camundongo com 7 semanas de idade.
As figuras 37A-37C são representações esquemáticas de análise de subconjunto e de rede de genes diferencialmente expressos em rins Col4A3-/- e modulados por tratamento de bloqueio com Ονβε mAb. Figura 37A: Diagrama de Venn das listas de conjuntos de sonda. As áreas dos círculos de Venn, suas uniões, e interseções são proporcionais aos números de conjuntos de sonda nas listas correspondentes. Figuras 37 B, 37C: As redes reguladores de maior escore inferidas das listas de conjuntos de sonda (>variação de 2 vezes entre rins Alport tratados e naíve, p<0,05) afetados pelos mAbs 3G9 bloqueadores de ανββ (figura 37B) e 8G6 figura 37c). As extremidades das redes mostram direções de interações entre os genes mostrados como os nodos e dispostos de acordo com sua localização celular.
Figura 38 mostra a análise imunoistoquímica e Taqman da expressão de TGF-βΙ . Coloração mostrada para uma seção representativa de cada grupo de tratamento. Figura 38A: Seções de rim de camundongos Col4A3+/- e Col4A3-/- tratados com agentes indicados imunocoloridos para expressão de TGF-βΙ . Figura 38B: Análise Taqman de níveis de mRNA de TGF-βΐ nos grupos de tratamento.
A figura 39 mostra coloração Tricrômica para expressão de co-lágeno em rins. Coloração em camundongos, 10 semanas de idade, ΰοΙ4Α3+/+;β6+/+, ΰοΙ4Α3-/-;β6+/+, e Col4A3-/-#6-/-. Seções teciduais re- presentativas são mostradas para regiões do córtex (figura 39A) e medulares (figura 39B) dos rins.
Figuras 40A e 40B são plotagens de dispersão que mostram i- munocoloração de SMA com titulação de dose do tratamento com 3G9. A análise quantitativa de imunocoloração de SMA é mostrada para regiões glomerulares (córtex) (figura 40A), e intersticiais (medula) (figura 40B) de rins depois do tratamento com doses designadas de mu3G9, ou 10 mg/kg de mu1 E6 (controle de IgG), 3 vezes por semana, de 3 a 7 semanas de idade. ED50 para córtex = 0,4 mg/kg; ED50 para medula = 0,3 mg/kg. As linhas horizontais representam os valores médios.
A figura 41 é uma série de fotomicrografias demonstrando a análise imunoistoquímica de expressão de ανββ em rim normal e rim depois de UUO. Figura 41 A: Rim, não lesionado, normal; figura 41B: 7 dias depois de UUO; figura 41 C: 10 dias depois de UUO; figura 41 D: 14 dias depois de UUO.
A figura 42 é uma série de fotomicrografias demonstrando que a supra-regulação de ο ββ ocorre em 18 semanas pós-radiação. Camundongos C57BL/6 irradiados com 14 Gy foram sacrificados em pontos de tempo indicados e seções de pulmão coloridas com o anticorpo anti-p6.
A figura 43 é um par de fotomicrografias demonstrando que a expressão de ανβ6 supra-regulada persiste em áreas de fibrose. Seções de pulmão foram coloridas para expressão de β6 como na figura 1. As seções eram de camundongos sacrificados nas 24 semanas (esquerda) ou 27 semanas (direita) depois da irradiação com 14 Gy. Ambas as seções mostram lesões fibróticas com numerosas células epiteliais expressando altos níveis de Ονββ. No epitélio não fibrótico adjacente, a expressão de ονββ permanece alta nas 24 semanas, mas é muito menos evidente pelas 27 semanas.
A figura 44 é uma série de fotomicrografias demonstrando que camundongos Itgb6-/- são protegidos da fibrose pulmonar induzida por radiação. Camundongos Itgb6+/+ e Itgb6-/- (base C57BIJ6) foram expostos à radiação torácica de 14 Gy. Depois de 27 semanas, os camundongos foram sacrificados e os pulmões esquerdos foram coloridos com tricromo de Mas- son. Pulmões representativos são mostrados; no total, 21/23 camundongos Itgb6+/+ tinham fibrose evidente, enquanto nenhum dos 17 camundongos Itgb6-/- tinham fibrose.
A figura 45 é um gráfico de barras demonstrando que os camundongos Itgb6-/- são protegidos de fibrose pulmonar induzida por radiação, conforme medição por hidroxiprolina. O teor de colágeno nos pulmões Itgb6+/+ irradiados é significantemente maior que aquele dos pulmões Itgb6+/+ não irradiados e de pulmões Itgb6-/- irradiados e não irradiados (p<0,03 versus Itgb6+/+ irradiado, N = 5-6 para cada grupo).
A figura 46 é um gráfico de linhas demonstrando que á ausência de integrina Ονββ não afeta a sobrevivência depois da irradiação do pulmão. Grupos de camundongos Itgb6+/+ e Itgb6-/- foram irradiados com 14 Gy. Curvas de sobrevivência para os dois grupos não diferem significantemente (WT = Itgb6+/+, KO = Itgb6-/-).
A figura 47 é uma plotagem de dispersão mostrando as medições da fibrose pulmonar em camundongos recebendo 3G9, TGF R solúvel ou Ab IP de controle sacrificados 27 semanas pós-irradiação. Fibrose pulmonar é prevenida nos camundongos que estavam recebendo 1 mg/kg/semana de 3G9. Cada ponto representa um camundongo individual, as barras representam as médias. Não houve diferença na fibrose entre o grupo de 0,3 mg/kg e o grupo de controle. O grupo de 1 mg/kg apresentou fibrose significantemente menor que os controles. Os grupos de 10 mg/kg e de receptor de TGF solúvel apresentaram menos fibrose, mas as diferenças de controle não foram significantes.
A figura 48 é uma plotagem de dispersão mostrando as medições de fibrose pulmonar em todos os camundongos (camundongos sacrificados, camundongos moribundos, e camundongos encontrados mortos de 20 a 26 semanas pós-irradiação) que estavam recebendo 3G9, TGF R ou Ab IP de controle. Os dados são apresentados como na figura 47. Não houve diferença na fibrose entre os camundongos de 0,3 mg/kg e o grupo de controle. Os grupos de 1 mg/kg, 10 mg/kg, e de receptor de TGF tinham significantemente menos fibrose que os controles.

A figura 49 é um gráfico de barras mostrando as contagens diferenciais de células do BAL de camundongos que estavam recebendo 3G9, TGF R solúvel ou Ab IP de controle sacrificados 26 semanas pós-irradiação.
A figura 50 é um gráfico de linhas demonstrando que os camundongos irradiados com 14 Gy, que estavam recebendo injeções de anticorpo 3G9 IP tiveram sobrevivência similar à do controle. A análise de sobrevivência foi realizada em todos os grupos como uma análise compósita (p = 0,088, C = controle, 0,3 = 0,3 mg/kg, 1 = 1 mg/kg, SoIR = receptor de TGF solúvel, 10 = 10 mg/kg.
A figura 51 é um gráfico de barras mostrando medições de fibrose em camundongos tratados com 3G9 (1 , 3, 6, ou 10 mg/kg), semanalmente, SC. São mostrados resultados separados para todos os camundongos (camundongos encontrados mortos/moribundos e sacrificados), camundongos sacrificados em 28 ou 32 semanas, e camundongos encontrados mortos/moribundos. Fibrose significantemente aumentada está presente nos controles em comparação com todos os grupos de anticorpos (p<0,05 para todas as doses versus controles).
A figura 52 é um gráfico de barras mostrando contagens diferenciais de células do BAL de camundongos que estavam recebendo 3G9 ou Ab de controle, SC, sacrificados 28 ou 32 semanas pós-irradiação. Doses de 3G9 de 3, 6 e 10 mg/kg resultam em percentagens significantemente aumentadas de ambos os neutrófilos e linfócitos (p<0,05 para todas as comparações).
A figura 53 é uma série de fotomicrografias mostrando a Aparência das células do BAL em camundongos de controle versus os tratados com 3G9. Macrofagos alveolares normais são vistos em citospina de controle. As células do BAL dos camundongos tratados com 1 mg/kg de 3G9 são similares aos controles. Em uma dose de 3 mg/kg, numerosos macrofagos espumosos grandes se tornaram evidentes. (Macrofagos similares são vistos em camundongos Itgb6-/-). Em doses maiores (6 mg/kg e, mostradas aqui, 10 mg/kg), aumentaram os números de neutrófilos (pontas das setas) e linfócitos são evidentes, bem como alguns fragmentos celulares.

A figura 54 é um gráfico de linhas mostrando curvas de sobrevivência de Kaplan-Meier para coorte de camundongos sacrificados 28 semanas pós-irradiação.
A figura 55 é um gráfico de linhas mostrando as curvas de so- brevivências de Kaplan-Meier para coorte de camundongos sacrificados 32 semanas pós-irradiação.
A figura 56 é um gráfico de barras demonstrando que a razão em massa de RV/LV é aumentada nos camundongos que morreram entre 29-32 semanas pós-irradiação, em comparação com os camundongos que sobreviveram às 32 semanas pós-irradiação. Os corações dos camundongos foram fixados em formalina. O ventrículo direito (RV) foi dissecado para separação do ventrículo esquerdo mais septo (LV), e os tecidos foram pesados. Sete camundongos não irradiados da mesma linhagem foram usados como controles. As barras representam médias +/- DESVIO PADRÃO. Os dados para os camundongos irradiados são mostrados para todos os camundongos (tratados com anticorpo de controle 1 E6 ou com qualquer dose de 3G9), camundongos tratados com anticorpo de controle 1 E6, e camundongos tratados com qualquer dose de 3G9. Os números de camundongos foram como a seguir: camundongos não irradiados, N = 7; camundongos tratados com 1 E6; sobreviveram N = 10, morreram N = 5; camundongos tratados com 3G9: sobreviveram, N = 8, morreram N = 9. A razão de RV/LV não foi significantemente diferente de controles não irradiados em camundongos que sobreviveram. Em contraste, a razão de RV/LV foi significantemente aumentada em camundongos que morreram (todos os camundongos e os subconjuntos de 1 E6 e 3G9) em comparação com os camundongos não irradiados (P<0,02). Também, a razão de RV/LV foi significantemente aumentada nos camundongos que morreram (todos os camundongos e os subconjuntos 1 E6 e 3G9) em comparação com os grupos de camundongos equivalentes que sobreviveram (P<0,007).
A figura 57 é um par de fotomicrografias mostrando pulmões de camundongos encontrados mortos que haviam sido tratados com anticorpo de controle (1 E6), esquerda, ou com o anticorpo θηίί-ανββ (3G9, 1 mg/kg/semana), direita. Observem áreas periféricas com ausências de eritrócitos nas paredes alveolares. Essa aparência é consistente com a perda de perfusão.
A figura 58 é uma série de fotomicrografias mostrando a expressão de Ονββ em doença pulmonar humana, demonstrando que a expressão de ονββ é fortemente supra-regulada em doença pulmonar humana. Seções de tecido em parafina de pulmão humano e de camundongo foram imuhoco- loridas com anticorpo específico de ανββ para visualizar níveis relativos de expressão em pulmão normal (figura 58A) e doente: Fibrose pulmonar idio- pática (figura 58B), doença pulmonar intersticial difusa (figura 58C) e doença pulmonar intersticial difusa (figura 58D). A coloração é representativa do nível de supra-regulação nas quarenta e uma amostras de pacientes diferentes mostradas abaixo na Tabela 16/1 (Exemplo 16).
A figura 59 é uma série de fotomicrografias mostrando que a expressão de ανββ é o modelo de fibrose pulmonar por bleomicina, demonstrando que a expressão de ανββ é fortemente supra-regulada no modelo de camundongo de fibrose pulmonar induzida por bleomicina. As seções de tecidos em parafina do pulmão do camundongo foram imunocoloridas com um anticorpo específico de θνββ para visualizar níveis relativos de expressão em pulmão instilado com bleomicina.
A figura 60 é uma série de gráficos de barras mostrando o efeito do tratamento com mu3G9 no teor de hidroxiprolina pulmonar em camundongos SV 29 tratados com bleomicina. Cada camundongo recebeu 4 mg/kg de mu3G9 (bloqueador de θνβ6 mAb), 1 E6 (lgG1 de controle) nos três primeiros experimentos mostrados para os vários períodos de tratamentos listados. No quarto período, cada camundongo recebeu PBS, 4 mg/kg de mu3G9 (bloqueador de θνβ6 mAb), 4B4 (não bloqueador de ανββ mAb), ou 8G6 (um segundo bloqueador de Ονββ mAb), três vezes por semana, por 15 a 60 dias depois do tratamento com bleomicina. Barras de erros representam erros padrão. Desvios médios de padrão dos grupos são fornecidos no Apêndice A do Exemplo 16.
A figura 61 é uma série de gráficos de barras mostrando o efeito do tratamento com mu3G9 no teor de colágeno (histomorfometria) em ca- mundongos C57B16 tratados com bleomicina. Os camundongos receberam 3 doses por semana de mu3G9 (bloqueador de ανββ mAb), 8G6 (um segundo bloqueador de ο ββ mAb), 1 E6 (mAb Igl de controle) ou sTGFbR (receptor de TGF-β solúvel - controle positivo para inibição de TGF-β). Nos três primeiros experimentos mostrados (figuras 61 A, 61 B e 61 C), os camundongos foram tratados começando no dia 1 antes do desafio com bleomicina e foram eutanizados no dia 14. Nos dois primeiros experimentos (figuras 61 e 61 B), doses de cada agente foram de 4 mg/kg, enquanto no terceiro experimento (figura 61 C) a dose de mu3G9 foi variada conforme mostrado. No experimento final (figura 61 D), os camundongos foram tratados começando nos 14 dias depois do desafio com bleomicina e foram eutanizados no dia 28. Seções histológicas foram coloridas com tricromo, imageadas, e a área do tecido colorido de azul (contendo colágeno) foi calculada como a percentagem da área total do tecido usando o software Metamorph. Barras de erros representam erros padrão. Médias e desvios padrão dos grupos são fornecidos no Apêndice B do Exemplo 16. * = significantemente diferente do grupo tratado com PBS por ANOVA.
A figura 62 é um gráfico de barras mostrando mu3G9 na fibrose pulmonar por bleomicina usando camundongos repórter de colágeno. Bleomicina foi instilada intratraquealmente nos camundongos repórter de coláge-no-luciferase. Os camundongos foram tratados, começando no dia antes da lesão com bleomicina, uma vez na semana por duas semanas com PBS, 5 mg/kg de TGF-bRIII-lg solúvel, ou mu3G9 em doses de 0,1 , 0,3, 1 ,0, 3 e 10 mg/kg. Um grupo adicional de camundongos tratados 3 vezes na semana com 4 mg/kg de mu3G9 foi também incluído (3X 4 mg/kg). Camundongos Sham foram instilados com solução salina intratraqueal e tratados com PBS. O teor de luciferase no pulmão ensaiado no dia 14. Barras de erros representam erros padrão. Médias e desvios padrão dos grupos são fornecidos no Apêndice C do Exemplo 16. * = significantemente diferente do grupo tratado com PBS por ANOVA.
A figura 63 é uma série de gráficos de linhas mostrando o curso de tempo para avaliar o efeito de doses eficazes baixas de mu3G9 nas po- pulações de células principais do BAL em camundongos desafiados com bleomicina. Os camundongos foram instilados com bleomicina nos pulmões no dia 0. Os camundongos foram tratados com PBS, mu3G9 em doses de 0,3, 1 ,0 e 3,0 mg/kg ou IgGI de controle (1 E6) em uma dose de 1 ,0 mg/kg nos dias -1 e +6. Os camundongos foram sacrificados nos dias 2, 5, 8 e 11 e os pulmões foram coletados e avaliados para contagens de células totais do BAL. As populações de macrófagos, neutrófilos e linfócitos foram analisadas por coloração diferencial de citospinas. As médias e os desvios padrão dos grupos são fornecidos no Apêndice C do Exemplo 16.
A figura 64 é uma série de gráficos de barras mostrando o efeito de altas doses de mu3G9 nas populações de células principais do BAL em camundongos desafiados com bleomicina. Os camundongos foram instilados com bleomicina nos pulmões no dia 0. Os camundongos foram tratados com PBS, mu3G9 em doses de 4, 20 e 40 mg/kg ou lgG1 mAb de controle (1 E6) em doses de 20 e 40 mg/kg nos dias -1 , +1 e +3. Os camundongos foram sacrificados no dia 5, e os pulmões foram coletados e avaliados para as contagens totais de células do BAL. Populações de macrófagos, neutrófilos e linfócitos foram analisadas por coloração diferencial de citospinas. As médias e desvios padrão dos grupos são fornecidos no Apêndice C do Exemplo 16. * = p<0,05 relativo aos controles desafiados com bleomicina, tratados com PBS, mas. não relativo aos controles tratados com TE6, lgG1 mAb.
A figura 65 mostra a falta de eficácia de mu3G9 em um modelo de bleomicina de doses múltiplas em hamsters. Os hamsters foram instilados com bleomicina (BL) ou solução salina (SA) nos pulmões nos dias 0, 7 e 14. Os hamsters foram tratados com PBS, mu3G9 (Ab1 ), ou lgG1 de controle (1 E6) começando no dia 0. Grupos adicionais foram tratados com mu3G9 no dia 7 (Ab2) ou no dia 14 (Ab3). Todos os anticorpos foram administrados três vezes por semana em uma dose de 5 mg/kg. Os hamsters que sobreviveram foram sacrificados no dia 28 e os pulmões foram coletados e avaliados quanto ao teor de hidroxiprolina (figura 65AA) e peroxidação lipídica (figura 65B). Barras de erros representam erros padrão. A sobrevivência dos hamsters através do estudo de blemomicina em doses múltiplas (figura 65C).

Não foi observada diferença significante na sobrevivência dos hamsters tratados com mu3G9 em comparação com grupos de controle tratados com PBS ou IgG. Os desvios médios e padrão dos grupos estão mostrados no Apêndice C do Exemplo 16.
A figura 66 mostra os perfis de intensidades de sinais normalizados para os genes identificados como significantemente afetados pelos tratamentos experimentais. Os camundongos tratados com 5 mg/kg de sTGF- bRII-lg (sR) ou com PBS ou com mu3G9 nas doses especificadas entre 0,3 e 30 mg/kg nos dias 1 , 8, 15 e 22 e foram eutanizados no dia 29 (sem período de recuperação) ou no dia 78 (período de recuperação de 7 semanas). RNA foi preparado dos pulmões dos camundongos tratados e os transcritos analisados.
A figura 67 mostra os perfis da expressão de gene para os genes mostrando uma tendência ascendente em 3 mg/kg de 3G9 no grupo de tratamento. Os camundongos foram tratados com 5 mg/kg de sTGFbRII-lg (sR) ou com PBS ou com mu3G9 nas doses especificadas entre 0,3 e 30 mg/kg nos dias 1 , 8, 15 e 22 e foram eutanizados no dia 29 (sem período de recuperação) ou no dia 28 com um período de recuperação de 7 semanas). RNA foi preparado dos pulmões dos camundongos tratados e os transcritos analisados.
A figura 68 é um par de gráficos de barras mostrando a anotação de IPA de genes significantemente afetados por mu3G9.
As figuras 69A e 69 B são mapas de redes mostrando esquematicamente as redes reguladoras que são afetadas por mu3G9 no pulmão do camundongo.
A figura 70 é um gráfico de barras mostrando a resposta de dose do transcrito MMP-12 ao tratamento com mu3G9.
A figura 71 é uma série de plotagens de dispersão de níveis de proteínas no fluido do BAL em camundongos normais e irradiados.
A figura 72 é uma série de plotagens de dispersão mostrando as proteínas que são supra-reguladas por fibrose induzida por radiação e que são sub-reguladas por tratamento com mu3G9 em 28 semanas.

Descrição Detalhada da Invenção
A menos que definido de outra forma aqui, todos os termos científicos e técnicos usados aqui têm os mesmos significados como comumente entendidos por aquele com versado na técnica à qual esta invenção pertence. Embora quaisquer métodos e materiais similares ou equivalentes àqueles descritos aqui possam ser usados na prática ou testes da presente invenção, os métodos e materiais preferidos são descritos abaixo. Exemplos de métodos e materiais são descritos abaixo, embora métodos e materiais similares ou equivalentes àqueles descritos aqui possam também ser usados na prática da presente invenção. Todas as publicações e outras referências mencionadas aqui estão incorporadas a título de referência em sua totalidade. Em caso de conflito, o presente relatório descritivo, incluindo definições, controlará. Os materiais, métodos, e exemplos são somente ilustrativos e não pretendem ser limitativos. Em todo este relatório descritivo, a palavra "compreender" ou variações tais como "compreende" ou "compreendendo" serão entendidas como incluindo um número inteiro estabelecido ou grupo de números inteiros, mas não excluindo qualquer outro número inteiro ou grupo de números inteiros.
Definições
Cerca de: Como usado aqui, quando em referência a qualquer valor numérico, o termo "cerca de" significa um valor de ±10% do valor estabelecido (por exemplo, "cerca de 50°C" engloba uma faixa de temperaturas de 45°C a 55°C, inclusive; similarmente, "cerca de 100mM" engloba uma faixa de concentrações de 90mM a 110mM, inclusive).
Antagonista: Como usado aqui, o termo "antagonista" refere-se a um composto, molécula, porção ou complexo que reduz, substancialmente reduz ou inibe completamente os efeitos biológicos e/ou fisiológicos da inte-grina ανββ em uma célula, tecido ou organismo. Antagonistas, que podem ser ligantes para ανββ, podem realizar tais efeitos em uma variedade de modos, incluindo, mas sem limitação, competir com um outro ligante por ligação a Ονββ sobre a superfície da célula, interagir com ανββ de tal modo a reduzir, reduzir substancialmente ou inibir a capacidade da integrina de se ligar a outros ligantes; ligar-se a e induzir uma alateração conformacional em θνβ6 da superfície celular, de modo que a integrina assume uma estrutura à qual outros ligantes não mais podem se ligar (ou podem ser ligar somente com afinidade/ou eficácia reduzida ou substancialmente reduzida); induzir uma alteração fisiológica (por exemplo, aumento dos complexos sinalizadores intracelulares; aumento dos inibidores transcricionais; redução da expressão de θνβ6 na superfície celular; etc.) em células, tecidos ou organismos de modo que a ligação de outros ligantes ou o sinal fisiológico induzido por tais ligantes mediante ligação à θνβ6 na células, é reduzido, reduzido substancialmente ou inibido completamente; e outros mecanismos pelos quais -anta- gonistas podem efetuar suas atividades, que serão familiares àquele versado na técnica. Como àquele versado na técnica entenderá, um antagonista pode ser uma estrutura similar a uma outra porção de ligação de Ονβε (por exemplo, um ligante de ligação de Ονββ) que antagoniza (por exemplo, o antagonista pode ser uma muteína, variante, fragmento ou derivado do agonis-ta), ou pode ter uma estrutura integralmente não relacionada.
Ligado: Como usado aqui, o termo "ligado" refere-se à ligação ou união que pode ser covalente, por exemplo, por acoplamento químico, ou não covalente, por exemplo, interações iónicas, interações hidrofóbicas, pontes de hidrogénio, etc. Ligações covalentes podem ser, por exemplo, éster, éter, fosfoéster, tioéster, tioéter, uretano, amida, amina, peptídeo, imida, hi-drazona, hidrazida, ligações carbono-enxofre, ligações carbono-fósforo, e similares. O termo "ligado" é mais amplo e inclui termos tais como "acoplado", "conjugado" e "unido".
Conjugado/conjugação: Como usado aqui, "conjugado" refere-se ao produto de ligação covalente de uma porção, por exemplo, uma substância química ou radioisótopo, a um ligante que se liga a Ογββ, um anticorpo que se liga a ανββ ou fragmento deste. "Conjugação" refere-se à formação de um conjugado como definido na sentença anterior. Qualquer método u-sado normalmente por aqueles versados na técnica de conjugação de substância química ou radioisótopos para materiais biologicamente ativos, tais como proteínas ou polipeptídeos (incluindo anticorpos), pode ser usado na presente invenção.
Doença, distúrbio, condição: Como usados aqui, os termos "doença" ou "distúrbio" referem-se a qualquer condição de um ser humano ou animal incluindo tumores, câncer, alergias, vícios, auto-imunidade, infecção, envenenamento ou comprometimento da função mental ou corporal. "Condições", como usado aqui, inclui doenças e distúrbios, mas também se refere aos estados fisiológicos. Por exemplo, fertilidade é um estado fisiológico, mas não uma doença ou distúrbio. As composições da invenção adequadas para prevenir gravidez por reduzir a fertilidade seriam, portanto, descritas como tratamento de uma condição (fertilidade), mas não um tratamento de um distúrbio ou doença. Outras condições são entendidas por aqueles com versado na técnica.
Quantidade Eficaz: Como usado aqui, o termo "quantidade eficaz" refere-se a uma quantidade de um dado composto, conjugado ou composição que é necessária ou suficiente para realizar um efeito biológico desejado. Uma quantidade eficaz de um dado composto, conjugado ou composição, de acordo com os métodos da presente invenção, seria a quantidade que atingiria este resultado selecionado, e tal que uma quantidade pode ser determinada como questão rotineira por aquele versado na técnica, usando ensaios que são conhecidos da técnica e/ou que estão descritos aqui, sem necessidade de experimentação indevida. Por exemplo, uma quantidade eficaz para tratar ou prevenir metástase de câncer poderia ser aquela quantidade necessária para prevenir migração e invasão de uma célula tumoral através da membrana basal ou através de uma camada endotelial in vivo. O termo é também sinónimo de "quantidade suficiente". A quantidade eficaz, para qualquer aplicação pode variar dependendo de fatores tais como a doença, distúrbio ou condição que está sendo tratada, a composição particular que está sendo administrada, a por meio de de administração, o tamanho do paciente, e/ou a gravidade da doença ou condição. Aquele com versado na técnica pode determinar, empiricamente, a quantidade eficaz de um composto particular, conjugado ou composição da presente invenção, de acordo com as instruções fornecidas aqui, sem necessidade de experimentação indevida.
Um ou uma: Quando os termos "um" e "uma" são usados neste relatório descritivo, eles significam "pelo menos um(a)" ou "um(a) ou mais", a menos que de outro modo indicado. Como tais, os termos "um(a)", "um(a) ou mais", e pelo menos um(a)" podem ser usados intercambiavelmente.
Peptídeo, polipeptídeo, proteína: Como usado aqui, o termo "po- lipeptídeo" tem o objetivo de englobar um "polipeptídeo" no singular, bem como "polipeptídeos" no plural, e refere-se a uma molécula composta de monômeros (aminoácidos) linearmente ligados por ligação amida (também conhecidas como ligações peptídiças). O termo "polipeptídeo" réfere-se a qualquer cadeia ou cadeia de dois mais aminoácidos, e não se refere a um comprimento específico do produto. Assim, peptídeos, dipeptídeos, tripeptí-deos, oligopeptídeos, "proteína", "cadeia de aminoácido", ou qualquer outro termo usado para fazer referência a uma cadeia ou cadeias de dois ou mais aminoácidos, estão incluídos na definição de "polipeptídeo", e o termo "polipeptídeo" pode ser usado em vez de, ou intercambiavelmente com quaisquer destes termos. O termo "polipeptídeo" tem também o objetivo de se referir aos produtos de modificação pós-expressão do polipeptídeo, incluindo, sem limitação, glicosilação, acetilação, fosforilação, amidação, derivati-zação por grupos protetores/bloqueadores conhecidos, clivagem proteolítica, ou. modificação por aminoácidos de ocorrência não natural. Um polipeptídeo pode ser derivado de uma fonte biológica natural ou se produzido por tecnologia recombinante, mas não é necessariamente traduzido de uma designada sequência de ácidos nucléicos. Ele pode ser gerado de qualquer maneira, inclusive por síntese química. De acordo com esta definição, os polipeptídeos usados na presente invenção podem ser de um tamanho de cerca de 3 ou mais, 5 ou mais, 10 ou mais, 20 ou mais, 20 ou mais, 25 ou mais, 50 ou mais, 75 ou mais, 100 ou mais, 200 ou mais, 500 ou mais, 1.000 ou mais, ou 2.000 ou mais aminoácidos. Os polipeptídeos podem ter uma estrutura tridimensional definida, embora eles não tenham necessariamente esta estrutura. Os polipeptídeos com uma estrutura tridimensional definida são referidos como dobrados, e polipeptídeos, que não possuem uma estrutura tridimen- sional definida, mas de preferência adotam um número grande de conformações diferentes, e são referidos como desdobrados. Como usado aqui, o termo glicoproteína refere-se a uma proteína acoplada a pelo menos uma porção carboidrato que é ligada à proteína por meio de uma cadeia lateral contendo oxigénio ou contendo nitrogénio de um resíduo de aminoácido, por exemplo um resíduo serina ou um resíduo asparagina. Polipeptídeos preferidos usados de acordo com a invenção incluem polipeptídeos que são ligan- tes ou que se ligam a uma integrina ανββ na superfície de uma célula, incluindo, mas sem limitação, anticorpos (especialmente anticorpos monoclonais) que reconhecem e se ligam a um ou mais epítopos sobre ο ββ- Por um poiipeptídeo "isolado" ou um fragmento, variante, ou derivativo deste deve ser entendido um poiipeptídeo que não está em seu ambiente natural. Nenhum nível particular de purificação é requerido. Por e-xemplo, um poiipeptídeo isolado por ser removido de seu meio nativo ou natural. Polipeptídeos e proteínas recombinantemente produzidos expressos em células hospedeiras são considerados isolados para o propósito de presente invenção assim como os polipeptídeos nativos ou recombinantes que tenham sido separados, fracionados, ou parcial ou substancialmente purificados por qualquer técnica adequada.
Também incluídos como polipeptídeos da presente invenção está fragmentos, derivados, análogos, ou variantes dos polipeptídeos acima ou qualquer combinação deles. Os termos "fragmento", "variante", "derivado" e "análogo", quando se referindo a anticorpos βηίί-θνββ ou polipeptídeos de anticorpo incluem quaisquer polipeptídeos que retêm pelo menos algumas das propriedades de ligação de antígeno do anticorpo correspondente ou poiipeptídeo, isto é, aqueles polipeptídeos que retêm a habilidade de se ligar a um ou mais epítopos em uma integrina ανββ· Fragmentos de polipeptídeos da presente invenção incluem fragmentos proteolíticos, bem como fragmentos de deleção, além de fragmentos de anticorpos específicos discutidos em outro lugar aqui. Variantes de anticorpos anti-oc^6 e polipeptídeos de anticorpos úteis de acordo com a presente invenção incluem fragmentos conforme descritos acima, e também polipeptídeos com sequências de aminoá- eidos alteradas devido às substituições, deleções, ou inserções de aminoácidos. Variantes podem ocorrer naturalmente ou podem não ocorrer naturalmente. As variantes que não ocorrem naturalmente podem ser produzidas usando técnicas de mutagênese conhecidas da área. Polipeptídeos variantes podem compreender substituições, deleções ou adições conservativas ou não conservativas de aminoácidos. Derivados de anticorpos anti-OvP6 e polipeptídeos de anticorpos úteis de acordo com a presente invenção são polipeptídeos que tenham sido alterados de modo a exibir características adicionais não encontradas no polipeptídeo nativo. Exemplos incluem proteínas de fusão. Polipeptídeos variantes podem ser também referidos aqui como "análogos de polipeptídeos". Como usado aqui, um "derivado" de um anticorpo anti-Ovp6 ou polipeptídeo de anticorpo refere-se a um polipeptídeo em questão tendo um ou mais resíduos quimicamente derivatizados por rea-ção de um grupo lateral funcional. Também incluídos como "derivados" são aqueles peptídeos, que contêm um ou mais derivados de aminoácidos que ocorrem naturalmente dos vinte aminoácidos padrão. Por exemplo, 4-hidroxiprolina pode substituir a prolina; 5-hidroxilisina pode substituir a lisina; 3-metilhistadina pode substituir a histidina; homosserina pode substituir a serina; e ornitina pode substituir a lisina.
Substancialmente, substancial: Como usado aqui, a conjugação de uma proteína é dita não interferir "substancialmente" com a habilidade da proteína de se ligar ao(s) seu(s) receptor(es) se a taxa e/ou quantidade de ligação de uma proteína conjugada a um receptor não forem menores que cerca de 40%, cerca de 50%, cerca de 60%, cerca de 65%, cerca de 70%, cerca de 75%, cerca de 75%, cerca de 80%, cerca de 85%, cerca de 90%, cerca de 91 %, cerca de 92%, cerca de 93%, cerca de 94%, cerca de 95%, cerca de 96%, cerca de 87%, cerca de 98%, cerca de 99% ou cerca de 100% ou mais, da taxa de ligação e/ou da quantidade da citocina, quimioci-na, fator de crescimento ou hormônio de polipeptídeo, correspondente, que não tenha sido conjugados.
Tratamento: Como usados aqui, os termos "tratamento", "tratar" e "tratando" se referem à profilaxia e/ou terapia, particularmente em que o objetivo da invenção é prevenir ou retardar (diminuir) uma alteração fisiológica indesejada ou distúrbio, tal como a progressão de esclerose múltipla. Estudos clínicos benéficos ou desejados incluem, mas sem limitação, alívio dos sintomas, diminuição da extensão da doença, estado estabilizado (isto é, não piorando) da doença, retardação e desaceleração da progressão da doença, atenuação ou mitigação do estado doentio, e remissão (se parcial ou total), se detectáveis ou não detectáveis. "Tratamento" pode significar também o prolongamento da sobrevivência em comparação com a sobrevivência esperada se não estiver recebendo tratamento. Aqueles que necessitam de tratamento incluem aqueles já com a condição ou distúrbio, bem como aqueles inclinados a terem a condição ou distúrbio ou aqueles onde a condição ou distúrbio é para ser prevenido. Por "sujeito", ou "indivíduo", ou "animal", ou "paciente", ou mamífero" deve ser entendido qualquer paciente, particularmente um paciente mamífero, para quem diagnóstico, prognóstico, ou terapia é desejada. Pacientes mamíferos incluem seres humanos e outros primatas, animais domésticos, animais de criação, animas de zoológico, animais para esporte, ou animais de estimação tais como cachorros, gatos, porquinhos-da-índia, coelhos, ratos, camundongos, cavalos, gado, vacas e similares.
Revisão
Esta invenção refere-se a anticorpos humanizados que são específicos para a integrina Ονββ· Descritos aqui estão vários métodos para produzir os anticorpos desta invenção. Métodos que são conhecidos na técnica, mas não estão especificamente descritos aqui, estão também dentro do escopo desta invenção.
A presente invenção também se baseia, pelo menos em parte, nas constatações que a integrina ανβε é expressa diferencialmente sobre as superfícies de células tumorais, em que ela é expressa em quantidades aumentadas nas células tumorais que são metastáticas ou têm um potencial metastático maior com relação aos níveis de expressão observados nas células tumorais que não são metastáticas ou que têm um potencial metastático menor. Para analisar essa expressão diferencial, a invenção usa ligantes, particularmente anticorpos (e mais particularmente os anticorpos humanizados proporcionados pela presente invenção), que se ligam à integrina θνβε. Em outras modalidades, a invenção proporciona também métodos que usam identificação dessa expressão diferencial na determinação do potencial invasivo e/ou metastático de células tumorais e na identificação daqueles carcinomas, tais como certos adenocarcinomas e carcinomas in situ (inclusive DCIS e LCIS), que podem ter maior probabilidade de progredir para carcinomas invasivos ou metastáticos. A invenção proporciona também métodos para identificar aqueles tumores onde a células que produzem o tumor têm mais probabilidade de responder ao tratamento com um ou mais ligantes que se ligam à integrina θνβ6. A invenção proporciona também métodos de diagnóstico e tratamento/prevenção de metástase tumoral, e para eliminação de células tumorais metastáticas residuais depois da excisão cirúrgica dos tumores.
Anticorpos Humanizados
Em uma modalidade, os anticorpos proporcionados pela presente invenção são anticorpos monoclonais, que, em uma modalidade preferida, são versões humanizadas de anticorpos anti-Ov 6 cognatos derivados de outras espécies. Um anticorpo humanizado é um anticorpo produzido por tecnologia de DNA recombinante, onde alguns ou todos os aminoácidos de uma cadeia leve ou pesada da imunoglobulina humana, que não são requeridas para ligação de antígeno (por exemplo, as regiões constantes e as regiões de estrutura dos domínios variáveis), são usados para substituir os aminoácidos correspondentes da cadeia leve ou pesada do anticorpo não humano cognato. A título de exemplo, uma versão humanizada de um anticorpo murino para um dado antígeno tem em ambas de suas cadeias pesadas e leves (1) regiões constantes de um anticorpo humano; (2) regiões de estrutura provenientes dos domínios variáveis de um anticorpo humano; e (3) CDRs provenientes do anticorpo murino. Quando necessário, um ou mais resíduos nas regiões de estrutura humana podem ser alteradas para resíduos nas posições correspondentes no anticorpo murino de modo a conservar a afinidade de ligação do anticorpo humanizado pelo antígeno. Essa alte- ração é algumas vezes chamada de "retromutação". Anticorpos humanizados são, em geral, menos prováveis de elicitar uma resposta imune em seres humanos em comparação com anticorpos humanos quiméricos, porque os anteriores contêm consideravelmente menos componentes não humanos.
Métodos adequados para produzir os anticorpos humanizados da presente invenção são descritos em, por exemplo, EP 0 239 400 (Winter); Jones et al., Nature 321 :522-525 (1986); Riechmann et al., Nature 332:323-327 (1988); Verhoeyem et al., Science 239: 1534-1536 (1988); Queen et al., Proc. Nat. Acad. Sei. USA 86:10029 (1989)); Patente US 6.180.370; e Orlandi et al., Proc. Natl. Acad. Sei. USA 86:3833 (1989); cujas exposições são aqui incorporadas a título de referência em suas totalidades. Geralmente, o transplante de CDRs murinas (ou outras de não-humano) em um anticorpo humano é conseguido como a seguir. Os cDNAs que codificam domínios variáveis de cadeias pesadas e leves são isolados de um hibridoma. As sequências de DNA dos domínios variáveis, incluindo as CDRs, são determinadas por sequenciamento. Os DNAs que codificam as CDRs são transferidos para as regiões correspondentes de um domínio variável de cadeias pesada ou leve de anticorpo humano que codifica a sequência por mutagê-nese direcionada a sítios. Então os segmentos de genes de regiões constantes humanos de um isótipo desejado (por exemplo, γΙ para CH e κ para ) são adicionados. Os genes de cadeias leve e pesada humanizados são CO' expressos em células hospedeiras mamíferas (por exemplo, células CHO ou NSO) para produzir anticorpo humanizado solúvel. Para facilitar a produção em larga escala de anticorpos, é frequentemente desejável produzir tais anticorpos humanizados em biorreatores contendo células que expressam anticorpos, ou produzir mamíferos transgênicos (por exemplo, cabras, vacas, ou carneiros) que expressam o anticorpo no leite (vide, por exemplo, Patente US 5.827.690).
Às vezes, a transferência direta de CDRs para uma estrutura humana leva a uma perda de afinidade de ligação com antígeno do anticorpo resultante. Isso porque em alguns anticorpos cognatos, certos aminoácidos dentro das regiões de estrutura interagem com as CDRs e assim influ- enciam a afinidade de ligação com antígeno total do anticorpo. Em tais casos, deve ser crítico introduzir "retromutação" (supra) nas regiões de estrutura do anticorpo aceptor de modo a reter a atividade de ligação de antígeno do anticorpo cognato.
A abordagem geral de produzir retromutações é conhecida da técnica. Por exemplo, Queen et al. (supra), Co et ai., Proc. Nat. Acad. Sei. USA 88:2869-2873 (1991 ), e WO 90/07861 (Protein Design Labs Inc.) descrevem uma abordagem que envolve duas etapas-chave. Em primeiro lugar, as regiões de estruturas variáveis humanas são escolhidas por análise computadorizada para homologia de sequências de proteínas, ótima, à estrutura de região variável do anticorpo murino variável. Então, a estrutura terciária da região murino variável é modelada pelo computador de modo a visualizar os resíduos de aminoácidos da estrutura que são prováveis de interagir com as CDRs murinas, e estes resíduos de aminoácidos murinos são então sobrepostos à estrutura humana homóloga.
Sob essa abordagem de duas etapas, existem vários critérios para desenhar anticorpos humanizados. O primeiro critério é usar como o aceptor humano a estrutura de uma imunoglobulina humana particular que é usualmente homóloga à imunoglobulina doadora não humana, ou usar uma estrutura de consenso de vários anticorpos humanos. O segundo critério e usar-o aminoácido doador em vez do aceptor se o resíduo de aceptor humano é incomum e o resíduo doador é típico para as sequências humanas em um resíduo específico da estrutura. O terceiro critério é usar o resíduo de aminoácidos de estrutura doador em vez do aceptor nas posições imediatamente adjacentes às CDRs.
Pode se usar também uma abordagem diferente conforme descrita, por exemplo, por Tempest, em Biotechnology (9: 266-271 (1991). Nessa abordagem as estruturas de regiões variáveis derivadas de cadeias leves e pesadas NEWN e REI, respectivamente, são usadas para enxertia de CDR sem introdução de radicais de resíduos de camundongo. Uma vantagem de se usar essa abordagem é que as estruturas tridimensionais das regiões variáveis NEWM e REI são conhecidas de cristalografia de raio X e assim as interações específicas entres as CDRs e os resíduos das estruturas da regiões variáveis podem ser prontamente modeladas.
Os presentes inventores prepararam o cDNA da região variável de cadeia pesada do anticorpo e os cDNAs da região variável da cadeia leve a partir de mRNAs isolados dos vários hibridomas 6.3G9 e 6.8G6, conforme descrição no WO 03/100033. Esses hibridomas produzem anticorpos mono- clonais de camundongo da classe de lgG1 que se ligam à integrina Ονββ- Vetores de expressão de anticorpo humano quimérico foram construídos por inserção do cDNA em um vetor de expressão contendo região constante de cadeia pesada de anticorpo humano ou sequências que codificam a região constante de cadeia leve de anticorpo humano. Tais vetores foram então introduzidos nas células animais para efetuar a produção de anticorpos humanos quiméricos anti-av 6- Dentre os anticorpos quiméricos produzidos, verificou-se que os anticorpos humanos quiméricos anti-avp6, 3G9 e 8G6, reagem com a integrina ανβδ e mostram atividade de bloqueio.
Usando as abordagens descritas acima, as versões humanizadas dos anticorpos quiméricos 3G9 e 8G6 foram geradas. Para o anticorpo 3G9, isso envolveu a clonagem das regiões variáveis de cadeias leves e pesadas de 3G9 murino, conforme descrição nos Exemplos aqui. Os cDNAs que codificam as regiões variáveis de 3G9 murino das cadeias leves e pesadas foram então usados para construir vetores para expressão de quimeras murino-humanas, onde as regiões variáveis de 3G9 murino foram ligadas às regiões constantes de lgG1 humano (para a cadeia pesada) e kappa humano (para a cadeia leve), conforme descrição nos Exemplos aqui. Expressão dos vetores de expressão de 3G9 da cadeia leve e da cadeia pesada seguinte à transfecção para células 293-EBNA indicou que as células transfec-tadas de 3G9 quimérico sintetizaram e montaram eficazmente as cadeias pesadas e leves e secretaram anticorpo (vide Exemplo 2). Além disso, uma forma de aglicosila-mutante do anticorpo 3G9 quimérico foi criada também. Uma substituição de aminoácido de uma asparagina (N) para uma serina (S) dentro de um sítio de glicosilação N-ligado na primeira CDR da cadeia leve do 3G9 mostrou que aperfeiçoa bastante a expressão de proteína e a purifi- cação sem alterar a afinidade de ligação (figura 1).
De modo a produzir anticorpos 3G9 humanizados, os domínios de estruturas aceptoras humanas foram escolhidos por emparelhamento de homologia com as sequências da germe-linha humana. Para a cadeia leve, verificou-se que as estruturas aceptoras L6 humanas são as mais homólogas e para a cadeia pesada, as estruturas aceptoras 3-7 humanas são as mais homólogas, conforme descrição no Exemplo 3. Usando essas estruturas aceptoras humanas escolhidas, os domínios variáveis das cadeias leves e pesadas foram desenhados e várias variantes/versões de cada foram geradas e expressas (Exemplo 4). .
A presente invenção descreve os anticorpos 3G9 humanizados como compreendendo um domínio variável de cadeia pesada da SEQ ID NO:1 e domínio variável de cadeia leve da SEQ ID NO:2.
SEQ ID NO: 1
EVQLVESGGGLVQPGGSLRLSCAASGFTFSRYWMSWVRQAPGKGLE WVASISSGGRMYYPDTVKGRFTISRDNAKNSLYLQMNSLRAEDTAV YYCARGSIYDGYYVFPYWGQGTLVTVSS SEQ ID NO: 2
EIVLTQSPATLSLSPGERATLSCSASSSVSSSYLYWYQQKPGQAPRLLIY STSNLASGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCHQWSTYPPTFG GGTKVEIK
Diferentes variantes/versões das cadeias pesadas e leves de 3G9 foram geradas com diferentes graus com retromutações para determinar que combinação produziu o melhor anticorpo humanizado com afinidade de ligação superior e atividade de bloqueio para θνβ6. Das cinco versões diferentes das cadeias leves as três versões diferentes de cadeias pesadas geradas, o emparelhamento da versão 3 da cadeia pesada (HV3) de 3G9 com a versão 5 da cadeia leve (LV5) de 3G9 gerou o melhor corpo humanizado (Exemplo 4). Essa versão 5 de 3G9 humanizado (H3/L5) é produzida por expressão do vetor recombinante para versão 3 da cadeia pesada (H3) compreendendo o plasmídio pKJS189 (SEQ ID NO:6) em combinação com o vetor recombinante para a versão 5 da cadeia leve (LV5) compreendendo o plasmídio pKJS195 (SEQ ID NO:5).
SEQ ID NO: 6
1263 ATG GAC TTC GGC CTG AGC TGG GTG TTC CTG GTG CTG GTG CTG AAG GGC GTG CAG TGC GAG GTG CAG CTG CTG GAG AGC GGC GGC 1 Mel Asp Pire Gly Leu Ser Trp Val Phe Leu Val Leu Val Leu LyB Gly Val Gln Cys Glu Val Gln Leu Va] Glu Ser Gly Gly
1347 GGC CTG GTG CAG CCC GGC GGC AGC CTG AGG CTG AGC TGC GCC GCC AGC GGC TTC ACC TTC AGC CGC TAC GTG ATG AGC TGG GTG 29 Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Arg Tyr Val Met Ser Trp Val
1431 CGC CAG GCC CCC GGC AAG GGC CTG GAG TGG GTG GCC AGC ATC AGC AGC GGA GGC CGC ATG TAC TAC CCC GAC ACC GTG AAG GGC 57 Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val Ala Ser lie Ser Ser Gly Gly Arg Met Tyr Tyr Pro Asp Thr Val LyB Gly
1515 CGC TTC ACC ATC AGC CGC GAC AAC GCC AAG AAC AGC CTG TAC CTG CAG ATG AAC AGC CTG CGC GCC GAG GAC ACC GCC GTG TAC 85 Arg Phe Thr He Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr Leu Gln Mel Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr
1599 TAC TGC GCC CGC GGC AGC ATC TAC GAC GGC TAC TAC GTG TTC CCC TAC TGC GGC CAG GGC ACC CTG GTG ACC GTG AGC TCC GCC 113 Tyr Cys Ala Arg Cly Ser lie Tyr Asp Gly Tyr Tyr Val Phe Pro Tyr Trp Gly Gln Gly Thr Leu Val Ttir Val Ser Ser Ala
1683 AGC ACC AAG GGC CCC AGC GTG TTC CCC CTG GCC CCC AGC AGC A AG AGC ACC AGC GGC GGC ACC GCC GCC CTG GGC TGC CTG GTG 141 Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val
1767 Ã AG GAC TAC TTC CCC GAA CCG GTG ACG GTG TCG TGG AAC TCA GGC GCC CTG ACC AGC GGC GTG CAC ACC TTC CCG GCT GTC CTA 1 9 Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu
1851 CAG TCC TC A GGA CTC TAC TCC CTC AGC AGC GTG GTG ACC GTG CCC TCC AGC AGC TTG GGC ACC CAG ACC TAC ATC TGC AAC GTG 197 Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr He Cys Asn Val
1935 AAT CAC AAG CCC AGC AAC ACC AAG GTG GAC AAG AAA GTT GAG CCC AAA TCT TGT GAC AAG ACT CAC ACA TGC CCA CCG TGC CCA 225 Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys Thr HiB Thr Cys Pro Pro Cys Pro
2019 GCA CCT GAA CTC CTG GGG GGA CCG TCA GTC TTC CTC TTC CCC CCA AAA CCC AAG GAC ACC CTC ATG ATC TCC CGG ACC CCT GAG 253 Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met He Ser Arg Thr Pro Glu
2103 GTC ACA TGC GTG GTG GTG GAC GTG AGC CAC GAA GAC CCT GAG GTC AAG TTC AAC TGG TAC GTG GAC GGC GTG GAG GTG CAT AAT 281 Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn
2187 GCC AAG AC A AAG CCG CGG GAG GAG CAG TAC AAC AGC ACG TAC CGT GTG GTC AGC GTC CTC ACC GTC CTG CAC CAG GAC TGG CTG 309 Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu
2271 AAT GGC AAG GAG TAC AAG TGC AAG GTC TCC AAC AAA GCC CTC CCA GCC CCC ATC GAG AAA ACC ATC TCC AAA GCC AAA GGG CAG 337 Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro He Glu Lys Thr He Ser Lys Ala Lys Gly Gln
2355 CCC CGA GAA CCA CAG GTG TAC ACC CTG CCC CCA TCC CGG GAT GAG CTG ACC AAG AAC CAG GTC AGC CTG ACC TGC CTG GTC AAA 365 Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Aan Gln Val Ser Leu Thr Cys Leu Val Lys
2439 GGC TTC TAT CCC AGC GAC ATC GCC GTG GAG TGG GAG AGC AAT GGG CAG CCG GAG AAC AAC TAC AAG ACC ACG CCT CCC GTG TTG 393 Gly Phe Tyr Pro Ser Asp He Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu 2523 GAC TCC GAC GGC TCC TTC TTC CTC TAC AGC AAG CTC ACC GTG GAC AAG AGC AGG TGG CAG CAG GGG AAC GTC TTC TCA TGC TCC

421 Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val P e Ser Cys Ser
2607 GTG ATG C AT G AG GCT CTG CAC AAC C AC TAC ACG CAG AAG AGC CTC TCC CTG TCT CCC GGT
449 Val Mel His GIu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly
SEQ ID NO: 5
1263 ATG GAC TTC CAG GTG CAG ATC TTC AGC TTC CTG CTG ATC AGC GTG AGC GTG ATC ATG AGC CGC GGC G AG ATC GTG CTG ACC CAG 1 Met Asp Phe Gln Val Gln lie Phe Ser Phe Leu He Ser Val Ser Val He Mel Ser Arg Gly GIu He Val Leu Thr Gln
1347 AGC CCC GCC ACC CTG AGC CTG AGC CCC GGC G AG AGG GCC ACC CTG AGC TGC AGC GCC AGC AGC AGC GTG AGC AGC AGC TAC CTG 29 Ser Pro Ala Thr Leu Ser Leu Ser Pm Gly GIU Arg Ala Thr Leu Ser Cys Ser Ala Ser Ser Ser Val Ser Ser Ser Tyr Leu
1431 TAC TGG TAC CAG CAG AAG CCC GGC CAG GCC CCC AGG CTG CTG ATC TAC AGC- ACC AGC AAC CTG GCC AGC GGC ATC CCC GCC CGC 56 Tyr Trp Tyr Gln Gl n Lys Pro Gly Gln Ala Pro Arg Leu Leu He Tyr Ser Thr Ser Asn Leu Ala Ser Gly He Pro Ala Arg
1515 TTC AGC GGC AGC GGC AGC GGC ACC GAC TTC ACC CTG ACC ATC AGC AGC CTG G AG CCC G AG GAC TTC GCC GTG TAC TAC TGC CAC 83 Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr He Ser Ser Leu GIu Pro GIu Asp Phe Ala Val Tyr Tyr Cys His
1599 CAG TGG AGC ACC TAC CCC CCC ACC TTC GGC GGC GGC ACC AAG GTG GAG ATC AAG CGT ACG GTG GCT GCA CCA TCT GTC TTC ATC 110 Gln Trp Ser Thr Tyr Pm Pro Thr Phe Gly Gly Gly Thr Lys Val GIu He Lys Arg Thr Val Ala Ala Pro Ser Val Phe He
1633 TTC CCG CCA TCT GAT GAG CAG TTG AA A TCT GGA ACT GCC TCT CTT GTG TGC CTG CTG AAT AAC TTC TAT CCC AG A GAG GCC A A A 137 Phe Pro Pro Ser Asp GIU Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg GIU Ala Lys
1767 GTA CAG TGG AAG GTG GAT AAC GCC CTC CAA TCG GGT AAC TCC CAG GAG AGT GTC ACA GAG CAG GAC AGC AAG GAC AGC ACC TAC 164 Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln GIu Ser Val Thr GIU Gln Asp Ser Lys Asp Ser Thr Tyr
1851 AGC CTC AGC AGC ACC CTG ACG CTG AGC AAA GCA GAC TAC GAG AAA CAC AAA GTC TAC GCC TGC GAA GTC ACC CAT CAG GGC CTG 1 1 Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr GIu Lys His Lys Val Tyr Ala Cys GIU Val Thr His Gln Gly Leu
1 35 AGC TCG CCC GTC ACA AAG AGC TTC AAC AGG GGA GAG TGT
218 Ser Ser Pro Val Thr Lys Ser Phe ΑΒΠ Arg Gly GIU Cys
Uma outra versão do anticorpo da versão 5 (H3/L5) de 3G9 humanizado foi também gerada na qual a cadeia pesada foi mutada para remover o sítio de glicosilação na região constante, que mostrou ser requerida para ligação de receptor de Fc normal (Exemplo 5). Essa forma aglicosila do anticorpo 3G9 humanizado (a-H3/L5) é produzida por substituição de um resíduo de aminoácidos asparagina (N) com uma glutamina (Q) na região constante da versão 3 da cadeia pesada (H3). O anticorpo (a-H3/l_5) 3G9 aglicosila-humanizado é produzido pela expressão do vetor recombinante para a versão 3 da cadeia pesada aglicosila (a-H3) compreendendo o pias- mídio pKJS196 (SEQ ID NO:7) em combinação com o vetor recombinante para a versão 5 da cadeia leve (L5) compreendendo o plasmídio pKJS195 (SEQ ID NO:5; vide acima).
SEQ ID NO: 7
1263 ATG GAC TTC GGC CTG AGC TGC GTG TTC CTG GTG CTG GTG CTG AAG GGC GTG CAG TGC GAG GTG CAG CTG GTG GAG AGC GGC GGC 1 Mel Asp Phe Gly Leu Ser Trp Val Phe u Val Leu Val Leu Lys Gly Val GIn Cys GIu Val GIn Leu Val GI Ser Gly Gly
1347 GGC CTG GTG CAG CCC GGC GGC AGC CTG AGG CTG AGC TGC GCC GCC AGC GGC TTC ACC TTC AGC CGC TAC GTG ATG AGC TGG GTG 29 Gly Leu Val GIn Pio Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Arg Tyr Val Mel Ser Trp Val
1431 CGC CAG GCC CCC GGC AAG GGC CTG GAG TGG GTG GCC AGC ATC AGC AGC GGA GGC CGC ATG TAC TAC CCC GAC ACC GTG AAG GGC 57 Arg GIn Ala Pui Gly Ly Gly Leu GIu Trp Val Ala Ser He Ser Ser Gly Gly Arg Mel Tyr Tyr Pro Asp Thr Val Lys Gly
1515 CGC TTC ACC ATC AGC CGC GAC AAC GCC A AG A AC AGC CTG TAC CTG CAG ATG AAC AGC CTG CGC GCC GAG GAC ACC GCC GTG TAC 85 Arg Phe Thr He Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr Leu GIn Mel Asn Ser Leu Arg Ala GIu Asp Thr Ala Val Tyr
1599 TAC TGC GCC CGC GGC AGC ATC TAC GAC GGC TAC TAC GTG TTC CCC TAC TGG GGC CAG GGC ACC CTG GTG ACC GTG AGC TCC GCC 113 Tyr Cys Ala Arg Gly Ser He Tyr Asp Gly Tyr Tyr Val Phe Pa) Tyr Trp Gly GIn Gly Thr Leu Val Thr Val Ser Ser Ala
1683 AGC ACC AAG GGC CCC AGC GTG TTC CCC CTG GCC CCC AGC AGC AAG AGC ACC AGC GGC GGC ACC GCC GCC CTG GGC TGC CTG GTG 141 Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val
1767 AAG GAC TAC TTC CCC GAA CCG GTG ACG GTG TCG TGG AAC TCA GGC GCC CTG ACC AGC GGC GTG CAC ACC TTC CCG GCT GTC CTA 169 Lys Asp Tyr Phe Pro GIu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu
1851 CAG TCC TCA GGA CTC TAC TCC CTC AGC AGC GTG GTG ACC GTG CCC TCC AGC AGC TTG GGC ACC CAG ACC TAC ATC TGC AAC GTG 1 7 GIn Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr GIn Thr Tyr He Cys Asn Val
1 35 AAT CAC AAG CCC AGC AAC ACC AAG GTG GAC AAG AAA GTT GAG CCC AAA TCT TGT GAC AAG ACT CAC ACA TGC CCA CCG TGC CCA 225 Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val GIU Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro
2019 GCA CCT GAA CTC CTG GGG GGA CCG TCA GTC TTC CTC TTC CCC CCA AAA CCC AAG GAC ACC CTC ATG ATC TCC CGG ACC CCT GAG 253 Ala Pro GIu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met He Ser Arg Thr Pro GIU
103 GTC ACA TGC GTG GTG GTG GAC GTG AGC CAC GAA GAC CCT GAG GTC AAG TTC AAC TGG TAC GTG GAC GGC GTG GAG GTG CAT AAT 281 Val Thr Cys Val Val Val Asp Val Ser His GIu Asp Pro GIu Val Lys Phe Asn Trp Tyr Val Asp Gly Val GIu Val His Asn
2187 GCC AAG AC A AAG CCG CGG GAG GAG CAG TAC CAG AGC ACG TAC CGT GTG GTC AGC GTC CTC ACC GTC CTG CAC CAG GAC TGG CTG 309 Ala Lys Thr Lys Pro Arg GIu GIu GIn Tyr GIn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His GIn Asp Trp Leu
2271 AAT GGC AAG GAG TAC AAG TGC AAG GTC TCC AAC AAA GCC CTC CCA GCC CCC ATC GAG AAA ACC ATC TCC AAA GCC AAA GGG CAG 337 ABn Gly Lys GIu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro lie GIu Lys Thr lie Ser Lys Ala Lys Gly GIn
2355 CCC CGA GAA CCA CAG GTG TAC ACC CTG CCC CCA TCC CGG GAT GAG CTG ACC AAG AAC CAG GTC AGC CTG ACC TGC CTG GTC AAA 365 Pro Arg GIu Pro GIn Val Tyr Thr Leu Pro Pro Ser Arg ABp GIu Leu Thr LyB Asn GIn Val Ser Leu Thr Cys Leu Val LyB 2439 GGC TTC TAT CCC AGC GAC ATC GCC GTC GAG TGG GAG AGC AAT GGG CAG CCG GAG AAC AAC TAC AAG ACC ACG CCT CCC GTG TTG

393 Gly Phe Tyr Pro Ser Asp lie Ala Val GIu Τιρ Glu Ser Asn Gly Gln Pro GIu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu
2523 GAC TCC GAC GGC TCC TTC TTC CTC TAC AGC AAG CTC ACC GTG GAC AAG AGC AGG TGG CAG CAG GGG AAC GTC TTC TCA TGC TCC

421 Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser
2607 GTG ATG CAT GAG GCT CTG CAC AAC CAC TAC ACG CAG AAG AGC CTC TCC CTG TCT CCC GGT
449 Val Mel His GIu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly
Abordagens similares foram usadas no desenho do anticorpo 8G6 humanizado (Exemplo 7). Três versões da cadeia leve variável e da cadeia pesada variável de 8G6 foram desenhadas, com a primeira versão contendo a maioria das retromutaçoes e a terceira versão contendo a minoria (a maioria dos "humanizados") (Exemplo 5).
SEQ IP NO: 75 (cadeia leve hu8G6 versão 1 )
DIVLTQSP ATLSLSPGERATLSCRASQSVSTSSYSYMYWYQQKPGQAP RFLIK Y AS NLES G LP ARFS GS G S GTDFTLTIS SLEPEDFA V Y YCQHNWEI PFTFGGGTKVEIK

SEQ IP NO: 76 (cadeia leve hu8G6 versão 2 )
El VLTQSPATLSLSPGER ATLS CR AS QSVSTSSYS YM Y WYQQKPGQ AP
RFLIK Y AS NLES G LP ARFS GS G S GTDFTLTIS S LEPEDFAVY YCQHNWEI PFTFGGGTKVEIK

SEQ IP NO: 77 (cadeia leve hu8G6 versão 3)
ErVLTQSP ATLSLSPGERATLSCRASQSVSTSSYSYMYWYQQKPGQ AP RLLIKYASNLESGIP ÀRFSGS GS GTDFTLTIS SLEPEDF AVYYCQHNWEI PFTFGGGTKVEK

SEQ IP NO: 78 (cadeia pesada hu8G6 versão 1 )
QVQLVQSGAEVKKPGASVKVSCKGSSYTFTDYAMHWVRLAPGQGLE WIGVISTYYGNTNYNQKFKGRATMTVDKSISTAYMELSRLRSDDTAV YY-CARGGLRRGDRPSLQYAMDYWGQGTLVTVSS

SEQ IP NO: 79 (cadeia pesada hu8G6 versão 2)
QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYAMHWVRQAPGQGL EWIGVISTYYGNTNYNQKFKGRATMTVDKSISTAYMELSRLRSDDTA VYY-CARGGLRRGDRPSLQYAMDYWGQGTLVTVSS SEQ 1D NO: 80 (cadeia pesada hu8G6 versão 3)
QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYAMHWVRQAPGQGL

EWMGVISTYYGNTNYNQKFKGRATMTVDKSISTAYMELSRLRSDDTA

VYYCARGGLRRGDRPSLQYAMDYWGQGTLVTVSS
Outras Porções
Como descrito com mais detalhes abaixo, os anticorpos mono-clonais humanizados desta invenção podem compreender ainda outras porções para efetuar as funções desejadas. Por exemplo, os anticorpos humanizados podem incluir uma porção toxina (por exemplo, toxóide do tétano ou ricina) ou um radionuclídeo (por exemplo, 11ln ou 90Y) para destruir células-alvo pelos anticorpos (vide, por exemplo, Patente US 6.307.026). Os anticorpos humanizados podem compreender uma porção (por exemplo, biotina, porções fluorescentes, porções radiativas, rótulo de histidina ou outros rótulos de peptídeos) para facilidade de isolamento ou de detecção. Os anticor-pos humanizados podem compreender também uma porção (por exemplo, biotina, porções fluorescentes, porções radioativas, rótulo de histidina ou outros rótulos de peptídeo) para facilitar isolação ou detecção. Os anticorpos humanizados podem também compreender uma porção que pode prolongar sua meia-vida no soro, por exemplo, uma porção polietileno glicol (PEG).
Uma variedade de agentes quimioterapêuticos pode ser acoplada ao anticorpo humanizado de direcionãmento. Preferivelmente, um anticorpo humanizado que internalize mediante ligação seria melhor, contudo, o uso de anticorpos humanos não internalizadores não é excluído. Por exemplo, o uso de conjugados de anticorpo-fármaco que se ligam a uma superfí-cie de células tumorais libera o fármaco dentro do tumor e na vizinhança das células tumorais e difusão ou transporte para a célula podem produzir ativi-dade tumoral dependendo do fármaco usado. A lista de fármacos que poderiam ser usados para preparar os conjugados é extensiva e aquele versado na técnica saberia fazer as modificações químicas no composto desejado de modo a efetuar reações mais convenientes daquele composto com a finalidade de preparar os conjugados da invenção. Por exemplo, o fármaco poderia ser acoplado por meio de ligantes liberáveis que são diferencialmente mais estáveis no soro e ainda liberam o fármaco ativo dentro da célula tumoral. Vários mecanismos de liberação poderiam ser usados, dependendo do fármaco específico. Exemplos desses mecanismos de liberação incluem o uso de hidrazonas sensíveis a ácido, ligantes sensíveis a redox, por exem- pio, dissulfeto e ligantes de peptídeos proteoliticamente clivados. Os seguintes são alguns dos fármacos representativos de várias classes diferentes:
(A) agentes alquilantes. Alguns exemplos específicos desses fármacos são ciclofosfamida, clorambucila, bussulfano, melfalano e nitrosou-réia.
(B) agentes antimetabólitos e antiproliferativos, tais como antra-ciclinas, fármacos da vinca, mitomicinas, bleomicinas, nucleosídeos, pteridinas, endiinas. Exemplos são adriamicina, daunorrubicina, doxorrubicina, aminopte-rina, metotrexato, mitomicina C, actinomicina-D, 5-fluoruracila, 6-mercapto-purina, citosina-arabinosídeo, taxol, taxano, citocalasina B, colchicina e pu-romicina-etoposídeo, melfalano, vimblastina, vincristina, caliqueamicina, derivados de maitansinas, e derivados de dolistatina.
(C) hormônios e antagonistas de hormônios tais como corticoste-róides, progestinas, e estrogênios.
Pró-fármacos são definidos como fármacos que existem em uma forma química "menos potente" quando, ligados ao anticorpo, que, no entanto, sob intemalização, são clivados enzimaticamente para produzir uma forma de fármaco mais potente. Essa mesma aplicação pode ser feita aos conjugados de anticorpo que não internalizam, por exemplo, clivagem enzimática ocorre na superfície da célula tumoral e o fármaco é liberado no ambiente do tumor imediato e assimilado pela célula tumoral. Alguns exemplos disso são fármacos contendo fosfatos, sulfatos, e peptídeos.
Ligação de toxinas protéicas biologicamente ativas, tais como cadeia A da ricina, toxina da difteria, shigatoxina, tétano, ou uma enzima tóxica é uma outra forma de conjugado de anticorpo contemplado por esta in-venção. Tais conjugados podem ser preparados usando métodos- químicos de conjugação ou usando técnicas de engenharia genética que permitem expressão direta da construção de anticorpo-toxina, que são prontamente conhecidas daquele versado na técnica.
Os anticorpos monoclonais humanizados desta invenção podem compreender também outras porções tais como radionuclídeos. Para os propósitos de radioimunoterapia, o uso de anticorpos ανβε humanizados para direciõnar radioisótopos terapêuticos no tratamento de câncer é contemplado por esta invenção. A lista de isótopos relevantes pode incluir, mas sem limitação, 90Y, 125l, 13 l, 123l, 1 1ln, 05Rh, 153Sm, 67Cu, 67Ga, 166Ho, 77Lu, 186Re e 88Re. Também contemplados são isótopos alfa-emissores tais como 211 At e 212Bi. Os métodos de ligação de isótopos são variados e dependem do isótopo específico usado. Aquele versado. na técnica estaria familiarizado com e seria capaz de determinar o método químico de conjugação para qualquer ligação de isótopo específico.
Para os propósitos de radioimunodiagnóstico, os anticorpos νββ humanizados pode proporcionar a oportunidade de se efetuar o imageamen-to e realizar a dosimetria para o câncer-alvo e/ou órgão/tecido doente de qualquer doença particular. Isso seria útil para confirmar a localização para os sítios tumorais conhecidos, bem como possibilitar a dosagem otimizada da administração terapêutica. Em particular, radioisótopos de pósitron (por exemplo, 86Y) além do isótopo-gama puro 99 Tc poderiam ser administrados durante a administração terapêutica.
- As aplicações de radioimunoterapia/radioimunodiagnóstico não estão limitadas ao uso de anticorpos não internalizadores. Existem exemplos do uso eficaz de anticorpos internalizadores para isótopos rótulos particularmente com isótopos que são retidos na célula como um quelato depois do catabolismo. Por exemplo, anticorpos marcados com 90Y preparados usando queladores de alta afinidade tal como MX-DTPA ou CHX-DTPA.
Quaisquer dos conjugados de anticorpo acima incluem também o uso de fragmentos Fab, F(ab')2, scFvs, minicorpos, construções de anticorpos com domínio CH2 deletado, e mutantes de FcRn. Esses fragmentos de Ab ou construções modificadas genericamente têm diferentes propriedades farmacocinéticas, de penetração de tumor, e de localização de tumor provenientes de IgG intacto, que podem produzir vantagens em aplicações particulares. Por exemplo, Fab de depuração mais rápida pode ser útil para aplicações em diagnóstico para usos em radioimunodiagnóstico. Por outro lado, para radioimunoterapia ou marcação de fármacos, um veículo de marcação com um t 2 sérico mais longo pode ser mais eficaz.
Condições Mórbidas e Modelos Animais
Os anticorpos humanizados da invenção são úteis no diagnóstico e tratamento, incluindo prevenção, de doenças mediadas por Ονββ- Por exemplo, esses anticorpos humanizados podem ser usados para tratar fibrose (por exemplo, fibrose pulmonar, lesão pulmonar aguda, fibrose renal, Síndrome de Alport, e esclerodermia), e outras doenças e distúrbios descritos em outro lugar, aqui, por bloqueio da ativação de TGF-β ou bloqueio da ligação de θνββ a quaisquer outros ligantes, tais como fibronectina, vitronec-tina, e tenascina. Em particular, os anticorpos humanizados desta invenção podem ser usados para tratar doenças pulmonares associadas à lesão/fibrose, tais como, mas sem limitação, fibrose pulmonar idiopática, fibrose induzida por radiação, doença pulmonar obstrutiva crónica (COPD), esclerodermia, fibrose induzida por bleomicina, asma crónica, silicose, fibrose induzida por asbestos, lesão pulmonar aguda e angústia respiratória crónica, (incluindo induzida por pneumonia bacteriana, induzida por trauma, induzida por pneumonia virai, induzida por ventilador, induzida por sepse não pulmonar e induzida por aspiração). Os anticorpos humanizados desta invenção podem ser também usados para tratar nefropatias crónicas associadas à lesão/fibrose tais como, mas sem limitação, lúpus, diabetes, esclerodermia, nefrite glomerular, esclerose glomerular segmentai focal, nefropatia por IgA, hipertensão, aloenxerto e doença de Alport. Os anticorpos humanizados podem ser também úteis para tratar fibrose do intestino, esclerodermia, fibrose induzida por radiação. Os anticorpos humanizados desta invenção podem ser usados, também, para tratar fibrose hepática tal como, mas sem limitação, fibrose induzida por lesão no dueto biliar. Outras indicações, que os anticorpos desta invenção podem ser úteis para tratar, incluem fibrose da cabeça e do pescoço, fibrose induzida por radiação, formação de cicatriz cor-neana, LASIX, transplante da córnea, trabeculectomia, formação de cicatriz hipertrófica, fibrose induzida por queimadura, fibrose cirúrgica, sarcoidose, psoríase e lesão/fibrose da medula espinal.
Como descrito em detalhes abaixo, diferentes de doenças ou condições fibróticas, os anticorpos humanizados da invenção são úteis no tratamento de câncer e metástase de câncer (incluindo crescimento e invasão de tumor), particularmente cânceres epiteliais. Um subconjunto de cân- ceres epiteliais compreende carcinoma de célula escamosa, por exemplo, cânceres da cabeça e pescoço (incluindo oral, laríngeo, faríngeo, esofágico), da mama, do pulmão, da próstata, cervical, do cólon, pancreático, da pele (carcinomas de células basais) e ovarianos. Nossos estudos usando os novos anticorpos monoclonais θνββ demonstraram que Ονββ é altamente expressa em muitos cânceres epiteliais na extremidade principal dos tumores. Os novos anticorpos podem ser também usados para outras doenças mediadas por Ονββ, incluindo psoríase.
A eficácia dos anticorpos da invenção pode ser testada em vários modelos animais, alguns dos quais estão descritos nos exemplos não limitativos abaixo. Modelos de camundongo para fibrose pulmonar incluem fibrose pulmonar induzida por bleomicina (Pitter et al., J. Clin. Invest. 107(12):1537-1544 (2001 ); e Munger et al., supra) e induzível por irradiação (Franko et al., Rad. Res. 140:347-355 (1994)). Em camundongos tratados com bleomicina, a expressão de «νββ aumenta nas células alveolares epiteliais dos pulmões. Contudo, camundongos de knockout β6 são protegidos de lesão e fibrose induzidas por bleomicina.
Modelos de camundongo para fibrose renal incluem camundon-gos COL4A3 -/- (vide, por exemplo, Cosgrove et al., Amer. J. Path., 157:1649-1659 (2000), camundongos com lesão induzida por adriamicina (Wang et al., Kidney International 58: 1797-1804 (2000); Deman et al., Nep-hrol Dial Transplant 16: 147-150 (2001 )), camundongos db/db (Ziyadeh et al., PNAS USA 97:8015-8020 (2000)), e camundongos com obstrução urete-ral unilateral (Fogo et al., Lab Investigation 81 : 189A (2001 ); e Fogo et al., Journal of the American Society of Nephrology 12:819A (2001 )). Em todos estes modelos, os camundongos desenvolvem lesão e fibrose renal que po- dem progredir para insuficiência renal. Ονββ é supra-regulada no revestimento epitelial dos túbulos ascendentes e descendentes dos rins dos camundongos COL4A3 -/-, camundongos tratados com adriamicina, e camundongos que sofrem de obstrução ureteral unilateral. É provável que expressão de Ονββ também aumente em uma variedade de modelos de lesão renal.
Como é também descrito em detalhes abaixo, anticorpos mono- clonais anti-ocvP6 podem ser igualmente testadas quanto à sua capacidade para inibir o crescimento, progressão, e metástase de tumor em tais modelos animais como os modelos de crescimento de tumor in vivo e metástase. Vi-de, por exemplo, Rockwell et al., J. A/a//. Câncer Inst. 49:735 (1972); Guy et al., Mol. CelI Biol. 12:954 (1992); Wyckoff et al., Câncer Res. 60:2504 (2000); e Oft et al., Curr. Biol. 8:1243 (1998). Ligantes ανββ importantes em câncer podem incluir TGF-β, que está envolvido em metástase (para revisão vide Akhurst et al., Trenós in Celi Biology 11 :S44-S51 (2001 )), fibronectina e vi-tronectina.
A eficácia dos tratamentos dessa invenção pode ser medida por várias ferramentas de diagnóstico disponíveis, incluindo exame físico, testes sanguíneos, medições de proteinúria, níveis de creatinina e depuração da creatinina, testes de função pulmonar, níveis de nitrogénio da uréia no sangue plasmático (BUN), observação e classificação de formação de cicatriz ou lesões fibróticas, deposição de matriz extracelular tais como colágeno, actina e fibronectina da musculatura lisa, testes de função dos rins, ultra-som, imageamento de ressonância magnética (MRI) e varredura por CT. Composições Farmacêuticas
A presente invenção proporciona composições farmacêuticas, que compreendem um ou mais anticorpos humanizados da presente invenção, ou derivados farmaceuticamente aceitáveis destes, opcionalmente com veículo farmaceuticamente aceitável. O termo "veículo", como usado aqui, inclui adjuvantes e veículos aceitáveis conhecidos.
De acordo com esta invenção, as composições farmacêuticas podem estar na forma de uma preparação injetável estéril, por exemplo, uma suspensão aquosa ou oleaginosa injetável estéril. Essa suspensão pode ser formulada de acordo com técnicas conhecidas na técnica usando agentes dispersantes, molhantes, e de suspensão.
As composições farmacêuticas desta invenção podem ser dadas via oral, tópica, intravenosa, subcutânea, intraperitoneal, intramuscular, in- tramedular, intra-articular, intra-sinovial, intraesternal, intratecal, intra- hepática, ou intracraniana, conforme desejado, ou simplesmente via local em sítios de inflamação ou crescimento de tumor. As composições farmacêuticas desta invenção podem ser também administradas por inalação através do uso de, por exemplo, um nebulizador, um inalador de pó seco ou um ina-lador com dosador.
A dosagem e a taxa de dose dos anticorpos desta invenção eficazes para produzir os efeitos desejados dependerão de uma variedade de fatores, tais como a natureza da doença a ser tratada, o tamanho do paciente, a meta do tratamento, a composição farmacêutica específica usada, e o critério do médico responsável pelo tratamento. Os níveis de dosagem de entre cerca de 0,001 e cerca de 100 mg/kg de peso corporal por dia, por e-xemplo, entre cerca de 0,1 e cerca de 50 mg/kg de peso corporal por dia, do composto de ingrediente ativo são úteis. Por exemplo, um anticorpo da invenção será administrado em uma dosagem que varia de cerca de 0,01 mg/kg de peso corporal/dia a cerca de 20 mg/kg de peso corporal/dia, por exemplo, variando de cerca de 0,1 mg/kg de peso corporal/dia a cerca de 10 mg/kg de peso corporal/dia, e em intervalos de a cada um a quatorze dias. Em uma outra modalidades, o anticorpo é administrado em uma dose de cerca de 0,3 a 1 mg/kg de peso corporal , quando administrado intraperito-nealmente. Em ainda uma outra modalidade, o anticorpo é administrado em uma dose de cerca de 5 a 12,5 mg/kg de peso corporal, quando administrado intravenosamente. Em uma modalidade, uma composição de anticorpo é administrada em uma quantidade eficaz para proporcionar um nível plasmático de anticorpo de pelo menos 1 mg/mL.
Outras dosagens adequadas e regimes e modos de administração serão familiares àqueles versados; outros serão ainda descritos em detalhes adicionais abaixo.

Ligantes Que Se Ligam à Integrina θνββ
Em uma modalidade adicional, a presente invenção é também direcionada a métodos para identificar células cancerosas metastáticas, ou para prognosticar o potencial metastático em um tumor (isto é a probabilida-de que as células no tumor sofrerão metástase do sítio do tumor primário para um sítio secundário ou metastático, in vivo), por determinação do nível de expressão da integrina ανββ pelas células, em que um aumento da expressão superficial celular de ανββ indica que a célula cancerosa está mais propensa a ser metastática. Em modalidades relacionadas, a invenção é direcionada_a métodos para eliminar células tumorais residuais que expressam Ονββ. particularmente células tumorais metastáticas, seguinte à intervenção médica para remover um tumor (por exemplo, excisão cirúrgica do tumor, ou redução quimioterapêutica ou radioterapêutica ou ablação do tumor). Em modalidades adicionais relacionadas, a invenção proporciona mé-todos para identificar formas não invasivas de carcinoma, particularmente de adenocarcinoma ou carcinomas in situ (tal como carcinoma ductal in situ (DCIS) ou carcinoma lobular in situ (LCIS) da mama), que são mais prováveis de progredirem para uma forma invasiva ou metastática. Certas de tais modalidades compreendem determinar o nível de expressão de integrina Ονββ em células de carcinoma, ou no mioepitélio que circunda o carcinoma, em seções de tecido obtidas de um paciente que sofre de tal carcinoma, em que um nível aumentado de expressão de integrina ανββ com relação às a-mostras de tecido não tumoral (idealmente, a partir do mesmo órgão no mesmo paciente) indica que o carcinoma é mais provável de progredir para uma forma invasiva ou metastática de câncer em algum momento, no futuro próximo. Em cada uma de tal modalidade, a invenção se baseia na identificação ou exploração da expressão aumentada de ο ββ em células tumorais, cuja identificação é obtida por contato do tecido, tumor ou células tumorais com um ou mais ligantes que se ligam à integrina θνββ no tecido, tumor ou células tumorais. Em certas modalidades, o tecido, tumor ou células tumorais são tecidos de carcinoma, tumores ou células tumorais, incluindo aqueles de carcinomas tais como adenocarcinomas. Em modalidades mais parti- culares, o carcinoma é um carcinoma da mama, carcinoma do endométrio, carcinoma pancreático, carcinoma colorretal, carcinoma do pulmão, carcinoma ovarianò, carcinoma cervical, carcinoma prostático, carcinoma do fígado, carcinoma esofágico, carcinoma da cabeça e do pescoço, carcinoma do estômago e carcinoma esplénico. Mais particularmente, o carcinoma é um carcinoma da mama (incluindo, mas sem limitação, carcinoma da mama in situ, tal como carcinoma ductal in situ (DCIS) ou carcinoma lobular in situ (LCIS)), carcinoma do endométrio, carcinoma pancreático, carcinoma colorretal, carcinoma cervical, ou carcinoma do pulmão.
Em certas modalidades da invenção, os ligantes que se ligam a ανββ são antagonistas de θνβ6. Tais antagonistas incluem, mas sem limitação, anticorpos, que especificamente se ligam a ανββ; anticorpos que se ligam especificamente a ββ; anticorpos que se ligam a ccv, anticorpos que se ligam a ligantes para θνβ6; ligantes para Ονββ; ácidos nucléicos anti-sentido; e peptídeo, não peptídeo, e análogos peptidomiméticos de tais ligantes.
Em certas de tais modalidades da presente invenção, o ligante que se liga à integrina ο ββ é um anticorpo que se liga à ανββ, ou fragmentos que se ligam à integrina Ονββ, variantes, ou derivativos destes. Tais anticorpos podem se ligar a uma subunidade da integrina (por exemplo, anticorpos que se ligam a um epítopo localizado na subunidade ocy ou a um epítopo que está localizado na subunidade ββ), ou a ambas as subunidades (por exemplo, anticorpos que se ligam a um epítopo que está localizado em uma região do heterodímero de integrina que seliga em ponte a ambas as subunidades otv e βε). A menos que se referindo especificamente a anticorpos de tamanho inteiro, tais como anticorpos de ocorrência natural, o termo "anticorpos Ονββ" engloba anticorpos de tamanho inteiro, bem como fragmentos de ligação de ο&νββ, variantes, análogos, ou derivados de tais anticorpos, por exemplo, anticorpo de ocorrência natural ou moléculas de imunoglobulina ou moléculas de anticorpos engenheiradas ou fragmentos que se ligam ao antí-geno de um modo similar às moléculas de anticorpo. Os anticorpos podem ser sintéticos, monoclonais, ou policlonais e podem ser feitos por técnicas bem-conhecidas da área. Para aplicações terapêuticas, anticorpos monoclo- nais "humanos" tendo regiões constantes e variáveis humanas são frequentemente preferidos de modo a minimizar a resposta imune de um paciente contra o anticorpo. Tais anticorpos podem ser gerados por imunização de animais transgênicos, que contêm genes da imunoglobulina humana (vide, Ja- kobovits et al., Ann N. Y. Acad. Sei. 764:525-535 (1995)). Em conexão com anticorpos sintéticos e semi-sintéticos, tais termos devem ser entendidos como a- brangendo, mas sem limitação, fragmentos de anticorpos, anticorpos deslocados por isótipo, anticorpos humanizados (por exemplo, camundongo-humano, humano-camundongo, e similares), híbridos, anticorpos tendo especificidades plurais, moléculas similares a anticorpos sintéticos inteiros, e similares.
Os termos "anticorpo" e "imunoglobulina" são usados aqui de forma intercambiável. Um anticorpo ou imunoglobulina compreende pelo menos o domínio variável de uma cadeia pesada, e compreende normalmente pelo menos os domínios variáveis de uma cadeia pesada e uma cadeia leve. Estruturas básicas de imunoglobulina em sistemas de vertebrados são relativamente bem-entendidas. Vide, por exemplo, Harlow et al., Antibo-dies: A Laboratory Manual, (Cold Spring Harbor Laboratoy Press, 2a Edição, 1988). Como será entendido por àqueles com versado na técnica, os termos "anticorpo" e "imunoglobulina" compreendem várias amplas classes de poli-peptídeos que podem ser distinguidos bioquimicamente. Aqueles versados na técnica apreciarão que- as cadeias pesadas são classificadas como gama, mu, alfa, delta, ou épsilon (γ, μ, α, δ, ε) com algumas subclasses dentre elas (por exemplo, γ1 - γ4). É a natureza dessa cadeia que determina a "classe" do anticorpo como IgG, IgM, IgA, IgG, ou IgE, respectivamente. As subclasses de imunoglobulina (isótipos), por exemplo, IgGi, lgG2, lgG3, lgG4, IgA^ etc. são bem-caracterizadas e são conhecidas por conferirem especialização funcional. As versões modificadas de cada uma dessas classes e isótipos são prontamente discerníveis por aquele versado na técnica em vista da presente exposição e, por conseguinte, estão dentro do escopo da presente invenção.
Anticorpos que se ligam a αν 6, ou a fragmentos de ligação de Ονββ. variantes ou derivados destes, que são úteis para uso na presente invenção incluem, mas sem limitação, anticorpos policlonais, monoclonais, multiespecíficos, humanos, humanizados, primatizados, ou quiméricos, anth corpos de cadeia simples, fragmentos de ligação de epítopo, por exemplo, Fab, Fab' e F(ab')2, Fd, Fvs, Fvs de cadeia simples (scFv), anticorpos de cadeia simples, Fvs ligado a dissulfeto (sdFv), fragmentos compreendendo um domínio VL ou VH, fragmentos produzidos por uma biblioteca de expressão de Fab, e anticorpos anti-idiotípicos (anti-ld) (incluindo, por exemplo, anticorpos Id a anticorpos anti-o<vp6 descritos aqui). Moléculas de ScFv são conhecidas na técnica e são descritas, por exemplo, na Patente US 5.892.019. Moléculas de imunogiobulina ou de anticorpos podem ser de qualquer tipo (por exemplo, IgG, IgE, IgD, IgA, e IgY), classe (por exemplo, lgG1 , lgG2, lgG3, lgG4, lgA1 e lgA2) ou subclasses da molécula de imunogiobulina.
Fragmentos de anticorpos, incluindo anticorpos de cadeia simples, podem compreender a(s) região(regiões) sozinha(s) ou em combinação com a integridade ou uma porção dos seguintes: região de articulação, domínios CR1 , CH2, e CH3. Também incluídos na presente invenção estão fragmentos de ligação de antígeno compreendendo também qualquer combinação de região(regiões) com uma região de articulação, domínios CH1 , CH2, e CH3. Anticorpos ou fragmentos específicos destes para uso nos métodos de diagnóstico e terapêuticos descritos aqui podem ser de qualquer origem animal incluindo pássaros e mamíferos. Preferivelmente, os anticorpos são anticorpos humanos, murino, de rato, de burro, de coelho, de cabra, de porquinho-da-índia, de lhama, de cavalo, bovinos ou de galinha. Mais preferivelmente, os anticorpos são anticorpos humanos, humanizados ou primatizados, ou anticorpos quiméricos, particularmente anticorpos mono-clonais. Como usado aqui, anticorpos "humanos" incluem anticorpos tendo a sequência de aminoácidos de uma imunogiobulina humana e incluem anticorpos isolados de bibliotecas de imunogiobulina humana ou de animais transgênicos para uma ou mais imunoglobulinas humanas e que não expressam imunoglobulinas endógenas, conforme descrição abaixo e, por e-xemplo, na Patente US 5.939.598 por Kucherlapati et al. Como usado aqui, o termo "anticorpo quimérico" será entendido como significando qualquer anticorpo, em que a região ou sítio imunorreativo é obtido ou derivado de uma primeira espécie e a região constante (que pode ser intacta, parcial ou modificada de acordo com a presente invenção) é obtida de uma segunda espécie. Em modalidades preferidas, a região ou sítio de ligação ao alvo provirá de uma fonte não humana (por exemplo, camundongo ou primata) e a região constante é humana.
Anticorpos particularmente preferidos para uso de acordo com a presente invenção são anticorpos monoclonais anti-Ovp6 tais como aqueles descritos por Weinreb et al., em J. Biol. Chem. 279(17):17875-17877 (2004) (cuja exposição é aqui incorporada a título de referência em sua totalidade), incluindo os anticorpos monoclonais 6.8G6 ("8G6") e 6.3G9 ("3G9") descritos aí. Anticorpos adicionais que se ligam a ανββ e que, portanto, são adequados para uso de acordo com a presente invenção incluem anticorpos (ou fragmentos, variantes ou derivados destes) que se ligam à subunidade β6 da integrina ανββ (e que são portanto considerados "anticorpos anti-p6"), tais como aqueles descritos por Weinacker et al., em J. Celi Biol. 269:1 -9 (1994), que é aqui incorporado a título de referência em sua totalidade; e na Patente US 6.692.741 B2, que é aqui incorporada a título de referência em sua totalidade, particularmente nas colunas 2-3 e 7-8 desta, incluindo o anticorpo monoclonal designado 10D5 (depósito ATCC N° HB12382, depositado em 6 de agosto de 1997, American Type Culture Collection, P.O. Box 1549, Ma-nassas, VA 20108) (vide Patente US 6.692.741 , coluna 3 linhas 7-13 e colunas 7-8) e CSp6 (vide Patente US 6.692.741 , colunas 7-8). Modalidades a-dequadas de acordo com esse aspecto da invenção usam ligantes de ligação de integrina ανββ, que são anticorpos
ou seus fragmentos de ligação de epítopo ανβ6. Anticorpos adicionais adequados para uso de acordo com esse aspecto da invenção incluem, mas sem limitação, os anticorpos monoclonais de ligação de θνβ6 descritos na publicação de Pedido de Patente US 2005/0255102 A1 , cuja exposição é aqui incorporada em sua totalidade, incluindo aqueles aí designados como 3G9, 8G6, 1A8, 2B1 , 2B10, 2A1 , 2E5, 1 G10, 7G5, 1 C5, bem como fragmentos, quimeras e híbridos destes. Anticorpos particularmente adequados para uso de acordo com a presente invenção são os anticorpos monoclonais 2B1 , 3G9 e 8G6.

Em algumas modalidades, os anticorpos compreendem as mesmas sequências de polipeptídeos de cadeias pesadas e leves como um anticorpo produzido por um hibridoma 6.1 A8, 6.3G9, 6.8G6, 6.2B1 , 6.2B10, 6.2A1 , 6.2ES, 6.2E5, 7.1G10, 7.7G5, ou 7.1 C5. Anticorpos particularmente adequados para uso de acordo com a presente invenção são anticorpos monoclonais que compreendem as mesmas sequências de polipeptídeos de cadeias pesadas e leves como os anticorpos 2B2 produzidos pelo hibridoma 6.2B1 (depósito ATCC N° PTA-36346, depositado em 16 de agosto de 2001 , American Type Culture Collection, P.O Box 1549, Manassas, VA 20108), os anticorpos 8G6 produzidos pelo hibridoma 6.8G6 (depósito ATCC N° PTA-3645, depositado em 16 de agosto de 2001 , American Type Culture Collection, P.O. Box 1549, Manassas, VA 20108) e os anticorpos 3G9 produzidos pelo hibridoma 6.3G9 (Depósito ATCC N° PTA-3649, depositado em 16 de agosto de 2001 , American Type Culture Collection, P.O Box 1549, Manassas, VA 20108) (vide Pedido Publicado US 2005/0255102 A 1 , cuja exposição é aqui incorporada a título de referência em sua totalidade, particularmente na página 1 , parágrafo 008; na página 2, parágrafos 0032 e 0036; e nos Exemplos nas páginas 6-14), e o anticorpo designado como 10D5 (se-cretando o hibrodoma, cujo anticorpo foi depositado em 6 de agosto de 1997, como depósito ATCC N° HB12382, American Type Culture Collection, P.O Box 1549, Manassas, VA 20108) (vide Patente US 6.692.741 , cuja exposição foi aqui incorporada a título de referência em sua totalidade, particularmente na coluna 3 linhas 7-13, e nas colunas 7-8).
Em algumas modalidades, os anticorpos compreendem uma cadeia pesada cujas regiões determinantes de complementaridade (CDR) 1 , 2 e 3 consistem essencialmente (isto é, com exceção de algumas variações conservativas) das sequências mostradas na Tabela I abaixo. Em certas de tais modalidades, os anticorpos compreendem uma cadeia pesada cuja C-DR1 consiste essencialmente em qualquer uma das SEQ ID Nos:101 -105, cuja CDR2 consiste essencialmente em qualquer uma das SEQ IO NOs:106-111 ; e cuja CDR3 consiste essencialmente em qualquer uma das SEQ ID NOs:1 12-117; e/ou uma cadeia leve cujas CDRs 1 , 2 e 3 consistem essenci- almente em qualquer uma das SEQ ID N0s:118-123, 124-127, e 128-1 respectivamente.
Anticorpos Sequências de Aminoácidos SEQ ID NO:

8G6 SYTFTDYAMH 101
1A8 SYTFTDYTMH 102
2BI GFTFSRYVMS 103
3G9 GFTFSRYVMS 103
2AI GYDFNNDLIE 104
2G2 GYAFTNYLIE 105
Sequências de CDR2 de Cadeia Pesada
8G6 VISTYYGNTNYNQKFKG 106
1A8 VI DTYYG KTN YNQKFEG 107
2BI SISSG-GSTYYPDSVKG 108
3G9 SISSG-GRMYYPDTVKG 109
2AI VINPGSGRTNYNEKFKG 110
2G2 VISPGSGHNYNEKFKG 1 11
Sequências de CDR3 de Cadeia Pesada
8G6 GGLRRGDRPSLRYAMDY 112
1A8 GGFRRGDRPSLRYAMDS 113
2BI GAIYDG — -"- YYVFAY 114
3G9 GSIYDG - — YYVFPY 115
2AI IYYGPH - — SYAMDY 116
2G2 ID-YSG - — PYAVDD 117
Sequências de CDR1 de Cadeia Leve
8G6 RASQSVSTSS-YSYMY 118
1A8 RASQSVSIST-YSYIH 119
2BI SASSSVSSS ----- YLY 120
3G9 SANSSVSSS ----- YLY 121
2AI KASLDVRTAVA 122
2G2 KASQAVNTAVA 123 Anticorpos Sequências de Aminoácidos SEQ
Sequências de CDR2 de Cadeia Leve
8G6 YASNLES 124
1A8 YASNLES 124
2BI STSNLAS 125
3G9 STSNLAS 125
2AI SASYRYT 126
2G2 SASYQYT 127
Sequências de CDR3 de Cadeia Leve
8G6 QHNWEIPFT 128
1A8 QHSWEIPYT 129
2BI HQWSSYPPT 130
3G9 HQWSTYPPT 131
2AI QQHYGIPWT 132
2G2 QHHYGVPWT 133
Em outras modalidades relacionadas, os anticorpos monoclonais de acordo com a presente invenção são anticorpos quiméricos, isto é aqueles em que um anticorpo cognato de uma espécie (por exemplo, murino, rato ou coelho) é alterado por tecnologia de DNA recombinante de modo que par-te ou todas as regiões de articulação e/ou constantes das cadeias pesadas e/ou leves são substituídas com os componentes correspondentes de um anticorpo proveniente de uma outra espécie (por exemplo, humana). Geralmente, os domínios variáveis do anticorpo engenheirado permanecem idênticos ou substancialmente assim para os domínios variáveis do anticorpo cognato. Tal anticorpo engenheirado é chamado de um anticorpo quimérico e é menos antigênico que o anticorpo cognato quando administrado a um indivíduo da espécie da qual a região de articulação e/ou constante é derivada (por exemplo, um ser humano). Métodos para produzir anticorpos quiméricos são bem-conhecidos da técnica.
Em outras modalidades relacionadas, os anticorpos monoclonais de acordo com a presente invenção são anticorpos integralmente humanos. Métodos para produzir tais anticorpos monoclonais integralmente humanos são bem-conhecidos na técnica (vide, por exemplo, US 2005/0255102 A1 , página 4, parágrafos 0069-0070, que é aqui incorporado a título de referência).
Em outras modalidades relacionadas, os anticorpos monoclonais usados de acordo com a invenção são versões humanizadas de anticorpos βηίί-ανββ cognatos derivados de outras espécies. Um anticorpo humanizado é um anticorpo produzido por tecnologia de DNA recombinante, em que alguns ou todos os aminoácidos de uma cadeia leve ou pesada de imunoglo-bulina humana que não são requeridos para ligação de antígeno (por exemplo, as regiões constantes e as regiões de estrutura dos domínios variáveis) são usados para substituir os aminoácidos correspondentes provenientes da cadeia leve ou da cadeia pesada do anticorpo não humano, cognato. A título de exemplo, uma versão humanizada de um anticorpo murino para um dado antígeno tem, em ambas de sua cadeia pesada e cadeia leve: (a) regiões constantes de um anticorpo humano; (b) regiões de estrutura dos domínios variáveis de um anticorpo humano; e (c) CDRs do anticorpo murino. Quando necessário, um ou mais resíduos nas regiões de estrutura humana podem ser alteradas para resíduos nas posições correspondentes de modo a conservar a afinidade de ligação do anticorpo humanizado para o antígeno. Essa alteração é algumas vezes chamada de "retromutação". Os anticorpos humanizados são geralmente menos prováveis de elicitar uma resposta i-mune em comparação com os anticorpos humanos quiméricos porque os primeiros contêm consideravelmente menos componentes humanos. Métodos para produzir tais anticorpos monoclonais humanizados são bem-conhecidos da técnica (vide, por exemplo, US 2005/0255102 A1 , páginas 4 e 5, parágrafos 0072-0077, que são aqui incorporados a título de referência).
Em tais modalidades adicionais, os anticorpos humanizados compreendem uma ou mais CDRs na cadeia pesada e/ou leve que são derivadas das CDRs correspondentes na cadeia pesada e/ou cadeia leve de um anticorpo diferente. Um exemplo não limitativo adequado de tal anticorpo é um anticorpo 3G9 humanizado compreendendo uma CDR1 de cadeia leve que tem a sequência da CDR1 de cadeia leve derivada do anticorpo 2B1 (SEQ ID NO:20) em vez da sequência da CDR1 da cadeia leve para o anti- corpo 3G9 depositado (SEQ ID NO:21 ). Tal anticorpo 3G9 humanizado tendo uma sequência de CDR1 de cadeia leve estabelecida na SEQ ID NO:20 é desenhada aqui como hu3G9 (ou BG00011). Um outro exemplo não limitativo adequado de tal anticorpo é um anticorpo 8G6 humanizado compreendendo uma CDR1 de cadeia leve que tem a sequência da CDR1 de cadeia leve derivada do anticorpo 2B1 (SEQ ID NO:20) em vez da sequência da CDR1 de cadeia leve para o anticorpo 8G6 depositado (SEQ ID NO:18). Tal anticorpo 8G6 humanizado tendo uma sequência de CDR de cadeia leve estabelecida na SEQ ID NO:20 é designada aqui como hu8G9. Exemplos adicionais de tais anticorpos derivados, em que uma mais das CDRs de cadeia pesada e/ou cadeia leve foram substituídas com uma ou mais CDRs correspondentes de cadeia pesada e/ou cadeia leve de um outro anticorpo, e que são adequados para uso de acordo com a presente invenção, serão prontamente aparentes para aqueles versado na técnica em vista das sequências mostradas na Tabela I e as instruções proporcionadas aqui. Métodos adequados para preparar tais anticorpos humanizados, incluindo tais anticorpos humanizados derivados, são familiares para aqueles versado na técnica e são mostrados, por exemplo, no Pedido de Patente Publicado US 2005/0255102 A1 , cuja exposição é aqui incorporada a título de referência em sua totalidade.
Conjugados e Outras Modificações de Ligantes de Ligação de

Em certas modalidades, os ligantes, por exemplo, os anticorpos que se ligam a Ονββ podem ser usados em forma não conjugada. Em outras modalidades, os ligantes, por exemplo, os anticorpos, que se ligam a ανβ6, por exemplo, a um rótulo detectável, um fármaco, pró-fármaco ou um isótopo.
Em certos métodos da invenção descrita aqui mais detalhadamente abaixo, tais métodos para detectar expressão de ανββ em células ou tecidos como uma medida do potencial metastático de células tumorais, ou como um modo de identificar carcinomas in situ (por exemplo, DCIS ou LCIS) em tecidos, os ligantes de ligação de Ονββ (por exemplo, anticorpos) são conjugados a um ou mais rótulos detectáveis. Para tais usos, os ligantes de ligação de ονββ, por exemplo, anticorpos de ligação de ανββ, podem ser detectavelmente marcados por ligação covalente ou não covalente de um agente cromogênico, enzimático, radioisotópico, isotópico, fluorescente, tóxico, quimioluminescente, de contraste de ressonância magnética nuclear ou outro rótulo.
Exemplos de rótulos cromogênicos adequados incluem diamino- benzidina e ácido 4-hidroxiazo-benzeno-2-carboxílico.
Exemplos de rótulos de enzima adequados incluem malato desi-drogenase, estafilococo nuclease, Δ-5-esteróide isomerase, álcool de levedura desidrogenase, fosfato de ct-glicerol desidrogenase, triose fosfato isomerase, peroxidase, fosfatase alcalina, asparaginase, glicose oxidase, β-galactosidase, ribonuclease, urease, catalase, glicose-6-fosfato desidrogenase, glicoamilase e acetilcolina esterase.
Exemplos de rótulos radioisotópicos adequados incluem 3H, 111ln, 125l, 131l, 32P, 35S, 14C, 51Cr, 57To, 58Co, 59Fe, 75Se, 152Eu, 90Y, 67Cu, 2 7Ci, 211At, 212Pb, 47Sc, 09Pd, etc. 11 ln é um isótopo preferido quando imageamento in vivo é usado, pois ele evita o problema de desalogenação dos ligantes de ligação a θνβ6 marcados com 25l ou 1311 pelo fígado. Além disso, esse radio-nucleotídeo tem uma energia de emissão gama mais favorável para o imageamento (Perkins et al., Eur. J. Nucl. Med. 10:296-301 (1985); Carasquillo et al., J. Nucl. Med. 28:281 -287 (1987)). Por exemplo, 111 In acoplado a anticorpos monoclonais com 1 -(P-isotiocianatobenzil)-DOTA mostrou pouca absorção em tecidos tumorais, particularmente o fígado, e, portanto, intensifica a especificidade da localização tumoral (Esteban et al., J. Nucl. Med. 28:861-870 (1987)).
Exemplos de rótulos isotópicos não radiativos incluem 57Gd, 55Mn, 162Dy, 52Tr, e 56Fe.
Exemplos de rótulos fluorescentes adequados incluem um rótulo de 15 Eu, um rótulo de fluoresceína, um rótulo de isotiocianato, um rótulo de rodamina, um rótulo de ficoeritrina, um rótulo de ficocianina, um rótulo de aloficocianina, um rótulo de Proteína Fluorescente Verde, um rótulo de o-ftalaldeído, e um rótulo de fluorescamina.

Exemplos de rótulos de toxina adequados incluem toxina da difteria, ricina, e toxina da cólera.
Exemplos de rótulos quimioluminescente incluem rótulo de lumi- nol, rótulo de isoluminol, rótulo de éster de acridínio aromático, rótulo de imi- dazol, rótulo de sal de acridínio, rótulo de éster de oxalato, rótulo de luciferi- na, rótulo de luciferase e rótulo de aequorina.
Exemplos de agentes de contraste de ressonância magnética nuclear incluem núcleos de metal pesado, tais como Gd, Mn, e ferro.
Técnicas típicas para ligar os rótulos descritos acima a ligante de ligação de. Ονββ, Por exemplo, anticorpos de ligação de θνβ6, são proporcionados por Kennedy et al., Clin. Chim. Acta 70:1 -31 (1976), e Schurs et al., Clin. Chim. Acta 81 :1-40 (1977). Técnicas de acoplamento mencionadas no último compreendem o método de glutaraldeído, o método de periodato, o método de dimaleimida, o método de éster de m-maleimidobenzil-N-hidróxi-succinimida, todos os quais são aqui incorporados a título de referência.
Para uso em certas abordagens terapêuticas da invenção, tal como ablação de células tumorais residuais seguinte à cirurgia, ou prevenção de metástase, os ligantes de ligação de ανβθ podem ser conjugados a um ou mais fármacos, pró-fármacos ou isótopos. Tais conjugados preferidos compreendem um ou mais ligantes, por exemplo, um ou mais anticorpos ou fragmentos, derivados ou variantes destes, que se ligam a ονβε, conjugados a um ou mais agentes citotóxicos; tais conjugados são úteis nos métodos de tratamento ou prevenção de metástase tumoral proporcionados pela invenção. De acordo com certas de tais modalidades da invenção, o ligante de ligação de ανβ6, por exemplo, anticorpo, é conjugado a um agente citotóxico. Agentes citotóxicos, por exemplo, quimioterapêuticos úteis na geração de conjugados de ligante de ligação de a^6-agente citotóxico são bem-conhecidos na técnica, e incluem, mas sem limitação, cisplatina, carboplati-na, oxaliplatina, paclitaxel, melfalano, doxorrubicina, metotrexato, 5-fluorura-cila, etoposídeo, meclorretamina, ciclofosfamida, e bleomicina. Outros agentes quimioterapêuticos adequados para uso de acordo com esse aspecto da invenção são bem-conhecidos e serão familiares àquele versado na técnica.

O uso de conjugados de uma ou mais ligantes de ligação de θνββ, por exemplo, um ou mais anticorpos de ligação de Ονββ, e uma ou mais toxinas de moléculas pequenas, tais como caliqueamicina, maitansina (Patente US 5.208.020), tricoteno, e CC1065, é também contemplado aqui. Em uma modalidade da invenção, o ligante de ligação de ανββ é conjugado a uma ou mais moléculas de maitansina (por exemplo, cerca de 1 a cerca de 10 moléculas de maitansina por ligante de ligação de ανββ)· Maitansina pode, por exemplo, ser convertida em May-SS-Me, que pode ser reduzida para May-SH3 e reagida com ligantes de ligação de ο βδ modificado (Chari et al., Câncer Research 52:127-131 (1992)) para gerar um conjugado dè maitansi-nóide-ligante de ligação de Ονββ- Alternativamente, o ligante de ligação de ο ββ pode ser conjugado a uma ou mais moléculas de caliqueamicina. A família de caliqueamicina de antibióticos é capaz de produzir rupturas em DNA de duplo filamento em concentrações sub-picomolares. Análogos estruturais de caliqueamicina, que podem ser usados, incluem, mas sem limitação, γΛ ci2 , 0C3 , N-acetil-γι\ PSAG e φτ (Hinman et al., Câncer Research 53: 3336-3342 (1993) e Lode et al., Câncer Research 58: 2925-2928 (1998)).
Toxinas enzimaticamente ativas e fragmentos destas, que po-dem ser usadas para produzir conjugados com um ou mais ligantes de ligação de Ονββ, por exemplo, um ou mais anticorpos de ligação de Ονβε, incluem cadeia A da difteria, fragmentos ativos não ligantes da toxina da difteria, cadeia A da exotoxina (proveniente de Pseudomonas aeruginosa), cadeia A da ricina, cadeia A da abrina, cadeia A da modeccina, alfa-sarcina, proteínas de Aleuritesfordii, proteínas de diantina, proteínas de Phytolaca americana (PAPI, PAPII, e PAP-S), inibidor de Momordica charantia, curcina, crotina, inibidor de Sapoanaria officinalis, gelonina, mitogelina, restrictocina, fenomi-cina, enomicina.e os tricotecenos. Vide, por exemplo, WO 93/21232 publicado em língua inglesa em 28 de outubro de 1993, cuja descrião é aqui incor-porada a título de referência, em sua totalidade. Mitansinoides podem ser também conjugados a um ou mais ligantes de Ονβε» por exemplo, um ou mais anticorpos de ligação de Ονββ· A presente invenção contempla ainda ligantes de ligação de Ονββ conjugados com um composto tendo atividade nucleolítica (por exemplo, uma ribonuclease ou uma DNA endonuclease tal como desoxirribonuclease; DNase).
Uma variedade de isótopos radiativos está também disponível para a produção de ligantes de ligação de ανββ para uso em métodos terapêuticos da invenção. Exemplos incluem 211At, 131l, 125l, 90Y, 86Re, 188Re, 153Sm, 212Bi, 32P e isótopos radiativos de Lu.
Conjugados dos ligantes de ligação de ανββ è agentes citotóxi-cos podem ser preparados usando uma variedade de . agentes de acoplamento tais como propionato de N-succunimidil-3-(2-piridiltiol) (SPDP), succi-nimidil-4-(N-maleimidometil)cicloexano-l-carboxilato, iminotiolano (IT), derivados bifuncionais de imidoésteres (tal como cloridrato de adipimidato de dimetila), ésteres ativos (tal como suberato de dissuccinimidila), aldeídos (tal como glutaraldeído), compostos de his-azido (tal como bis(p-azidobenzoil) hexanodiamina), derivados de bis-diazônio (tal como bis-(p-diazoniobenzoil)-etilenodiamina), diisocianatos (tal como 2,6-diisocianato de tolieno), e compostos de flúor bis-ativos (tal como 1 ,5-diflúor)-2,4-dinitrobenzeno). Por e-xemplo, uma imunotoxina de ricina pode ser preparada conforme descrição por Vitetta et al., Science 238: 1098 (1987). O ácido 1 -isotiocianatobenzil-3-metildietileno triaminopentaacético marcado com 14C (MX-DPTA) é um exemplo de agente quelante para conjugação de radionucleotídeo ao ligante de ligação de ανβ6. Vide WO 94/1 1026. O ligante pode ser um "ligante clivável" facilitador de liberação do fármaco citotóxico na célula. Por exemplo, um ligante ácido-lábil, ligante sensível à peptidase, ligante de dimetila ou ligante contendo dissulfeto (Chari et al., Câncer Research 52:127-131 (1992)) pode ser usado.
Alternativamente, uma proteína de fusão compreendendo um ligante de ligação de ανββ e agente citotóxico pode ser feita, por exemplo, por técnicas recombinantes ou síntese de peptídeo.
Em ainda uma outra modalidade, o ligante de ligação de ανβ6 pode ser conjugado a um "receptor" (tal como estreptavidina) para uso em "pré-marcação", em que o conjugado de ligante de ligação de o Pe-receptor é administrado ao paciente, seguido por remoção de um conjugado não ligado da circulação usando um agente de depuração e então administração de um ligante (por exemplo, avidina) que é conjugado a um agente citotóxico (por exemplo, um radionuclídeo).
Os ligantes de ligação de θνβ6 da presente invenção podem também ser conjugados com uma enzima ativadora de pró-fármaco, que converte um pró-fármaco (por exemplo, um agente quimioterapêutico de peptidila, vide WO 81/01 145) em um fármaco ativo. Vide por exemplo, WO 88/07378 e a Patente US 4.975.278. O componente enzimático dè tais conjugados inclui qualquer enzima capaz de agir em um pró-fármaco de tal modo a convertê-lo em sua forma citotóxica mais ativa.
Enzimas que são úteis no método desta invenção incluem, mas sem limitação, fosfatase alcalina útil para converter pró-fármacos contendo fosfato em fármacos livres; arilsulfatase útil para converter pró-fármacos contendo sulfato em fármacos livres; citosina desaminase útil para converter 5-fluorcitosina atóxica no fármaco anticâncer, 5-fluoruracila; proteases, tais como Serratia protease, termolisina, subtilisina, carboxipeptidases e catepsi-nas (tais como catepsinas B e L), que são úteis para converter pró-fármacos contendo peptídeos em fármacos livres; D-alanilcarboxipeptidases, úteis para converter pró-fármacos que contêm substituintes D-aminoácidos; enzimas clivadoras de carboidrato tais como O-galactosidase e neuraiminidase útil para converter pró-fármacos glicosilados em fármacos livres; P-lactamase útil para converter fármacos derivatizados com P-lactans em fármacos livres; e penicilina amidases, tal como penicilina V amidase e penicilina G amidase, úteis para converter fármacos derivatizados em seus nitrogênios de amina com os grupos fenoxiacetila ou fenilacetila, respectivamente, em fármacos livres.
As enzimas podem ser covalentemente ligadas ao ligante de ligação de Ονββ por técnicas bem-conhecidas na área, tal como o uso dos reagentes de reticulação heterobifuncionais. Alternativamente, proteínas de fusão compreendendo pelo menos a região de ligação de antígeno de um ligante de ligação de ανββ da invenção ligada a pelo menos uma porção funcionalmente ativa de uma enzima podem ser construídas usando técnicas de DNA recombinante bem-conhecidas na área (vide, por exemplo, Neuberger et al., Nature 312: 604-608 (1984)).
Diagnóstico e Prognósticos das Doenças
Foi verificado que as células de certos tumores que são metastá- ticos expressam níveis significantemente aumentados de integrina ανββ quando em comparação com células que são menos metastáticas ou não metastáticas. Além disso, os presentes inventores descobriram que em certas formas de carcinoma in situ, por exemplo, carcinoma ductal in situ (DCIS) ou carcinoma lobular in situ (LCIS) da mama, o mioepitélio que circunda o tumor expressa níveis significantemente aumentados de integrina ανββ com relação às células tumorais do carcinoma e com relação ao tecido de mama normal. Assim, a invenção proporciona um método útil para diagnosticar o potencial metastático de uma célula tumoral, incluindo tumores de carcinomas tal como um adenocarcinoma. Em modalidades mais particulares, o carcinoma é um carcinoma da mama, um carcinoma do endométrio, um carcinoma pancreático, um carcinoma colorretal, um carcinoma do pulmão, um carcinoma ovariano, um carcinoma cervical, um carcinoma prostático, um carcinoma do fígado, um carcinoma esofágico, um carcinoma da cabeça ou do pescoço, um carcinoma do estômago ou um carcinoma esplénico. Mais particularmente, o carcinoma é um carcinoma da mama (incluindo, mas sem limitação, um carcinoma da mama in situ, tal como carcinoma ductal in situ (DCIS) ou carcinoma lobular in situ (LCIS), um carcinoma do endométrio, um carcinoma pancreático, um carcinoma colorretal, um carcinoma cervical, ou um carcinoma do pulmão.
Métodos, de acordo com este aspecto da invenção, envolvem ensaiar o nível de expressão de Ονββ nas células tumorais ou no mioepitélio em uma amostra de tecido, e comparar esses níveis de expressão com um nível de expressão de Ονβα padrão (por exemplo, em células normais, células não metastáticas, ou tecido normal, preferivelmente obtidos do mesmo animal, tal como um paciente humano), em que um aumento da expressão de Ονβε em um tumor ou nas células deste é indicativo de um potencial invasivo e/ou metastático maior daquelas células tumorais ou de suas células, ou em que um aumento da expressão de (Α,ββ no mioepitélio que circunda um tumor ou cluster de células epiteliais em uma seção tecidual é indicativo da presença de um carcinoma in situ, por exemplo, DCIS ou LCIS, que é mais provável de se tornar invasivo e potencialmente formar metástases.
Se um diagnóstico de câncer já foi feito de acordo com métodos convencionais, a presente invenção é útil como um indicador prognóstico, por meio de que as células tumorais exibindo níveis aumentados de expressão de Ονββ serão preditas como tendo maior probabilidade de sé tornarem invasivas e metastatizarem a partir do sítio de tumor primário para um sítio metastático distai. Similarmente, se um diagnóstico suspeito de um carcinoma in situ foi realizado de acordo com métodos convencionais (por exemplo, detecção mamográfica de nódulos calcificados na mama), a presente invenção é útil como um indicador confirmatório, por meio do que o tecido que foi submetido à biópsia da área de calcificação exibindo níveis aumentados de expressão de ανββ no mioepitélio indica a presença de um carcinoma in situ, por exemplo, DCIS ou LCIS, que se tornarão invasivos e podem responder ao tratamento com ανβε mAb. Com base em tais resultados prognósticos e diagnósticos, o médico responsável pelo tratamento pode então ajustar o regime de tratamento de acordo, proporcionando assim detecção mais cedo de uma condição pré-metastática ou pré-cancerosa e assim uma resultado clínico mais favorável para o paciente.
Por "ensaiando os níveis de expressão de ανββ" deve ser entendido medir ou avaliar qualitativa e quantitativamente os níveis de Ονβε em uma primeira amostra biológica (por exemplo, uma amostra de tumor, uma biópsia de tecido, ou aspirado, etc.) tanto diretamente (por exemplo, por determinação ou avaliação da quantidade absoluta de a^na amostra) como relativamente (por exemplo, por comparação do nível de expressão de ανββ em uma primeira amostra biológica com aquele em uma segunda amostra biológica). Preferivelmente, o nível de Ονββ na primeira amostra biológica é medido ou avaliado e comparado com aquele em um padrão tirado de uma segunda amostra biológica obtida de um indivíduo que não tem câncer ou lesão pré-cancerosa. Como será apreciado por aquele versado na técnica, uma vez que um nível de expressão de θνβ6 padrão é conhecido para um dado tecido não canceroso, ele pode ser usado repetidamente como um padrão para comparação.
Por "amostra biológica" deve ser entendido qualquer amostra biológica obtida de um indivíduo (tal como um paciente), linhagem celular, cultura de tecido, ou de outra fonte, que pode conter células ou produtos celulares, tal como matriz extracelular. Tais amostras biológicas incluem tecidos e células do corpo, incluindojeucócito, ovário, próstata, coração, placenta, pâncreas, fígado, baço, pulmão, mama, tecidos da cabeça e do pescoço (por exemplo, tecidos orais, faríngeos, linguais e laríngeos), tecidos do en-dométrio, cólon (ou colorretal), cervical, do estômago e umbilicais, que podem expressar ανββ· Métodos para obter biópsias de tecidos e fluidos corporais de mamíferos são bem-conhecidos na técnica. Os mamíferos preferidos incluem macacos, gatos, cachorros, vacas, porcos, cavalos, coelhos e seres humanos. Particularmente preferidos são os seres humanos.
Ensaio dos níveis de expressão de ονββ em uma amostra biológica pode ser feito usando qualquer método conhecido da técnica. Preferidas para ensaio dos níveis de expressão de ανββ em uma amostra biológica são as técnicas imunobiológicas. Por exemplo, expressão de ο βε em tecido pode ser estudada com métodos imunoistológicos clássicos. Nesses, o reconhecimento específico é proporcionado por um ligante primário, por e-xemplo, um anticorpo (policlonal ou monoclonal), que se ligada a ο ββ- Esse ligante primário pode ser marcado, por exemplo, com um rótulo fluorescente, quimioluminescente, fosforescente, enzimático ou radioisotônico. Alternativamente, esses métodos da invenção podem usar um sistema de detecção secundário no qual um segundo ligante que reconhece e se liga ao ligante de ligação de Ονββ, por exemplo, um assim chamado anticorpo "secundário", que reconhece e se liga a um primeiro anticorpo de ligação de θνββ, é detec-tavelmente marcado como descrito acima. Como resultado, uma coloração imunoistológica da seção de tecido para exame patológico é obtida. Alterna- tivamente, os tecidos e amostras de células podem também ser extraídos, por exemplo, com uréia e detergente neutro, para a liberação de proteína οίνββ para o ensaio Western blot ou dot/slot (Jalkanen, M., et al., J. Celi. Biol. 101 :976-985 (1985); Jalkanen, M., et al., J. Celi Biol. 105:3087-3096 (1987)) para quantificação direta, com relação a um tecido padrão ou amostra de célula conhecidos como tendo níveis mais baixos de expressão de θνββ- Como notado acima, os métodos da presente invenção são úteis para detectar cânceres metastáticos em mamíferos, para determinar o potencial metastático de uma célula tumoral (isto é predizer a probabilidade que uma dada célula tumoral metastatizará do sítio tumoral primário para um sítio metastático distai), e para determinar a probabilidade que um carcinoma não invasivo ou in situ progredirá para um carcinoma invasivo ou metastático. Em particular, os métodos da invenção são úteis para detectar cânceres invasivos e/ou metastáticos de células epiteliais (isto é carcinomas invasivos e/ou metastáticos), incluindo tecidos da mama, ovário, próstata, fígado, pulmão, pâncreas, cólon (ou colorretal), tecidos da cabeça e do pescoço (por exemplo, tecidos orais, linguais e laríngeos) do endométrio, da cérvice, estômago e baço. Particularmente adequados para detecção pelos métodos da presente invenção são os adenocarcinomas metastáticos, incluindo, mas sem limitação, carcinomas do pulmão, carcinomas pancreáticos, carcinomas colorretais, carcinomas cervicais, carcinomas do pulmão, carcinomas in situ, tal como certo carcinoma ductal in situ (DCIS) ou carcinoma lobular in situ (LCIS) da mama, que têm probabilidade elevada para progredir para um fe-nótipo invasivo e/ou metastático. A identificação e o tratamento precoces de tais carcinomas estão associados a um melhor prognóstico de longo prazo para os pacientes. Por exemplo, foi reportado que se deixado não tratado, uma proporção significante de tumores DCIS se tomam invasivos e podem levar a cânceres metastáticos que têm um prognóstico bem mais pobre (vide Sakorafas, G.H., e Tsiotou, A.G.H., Câncer Treatment Rev. 26:103-125 (2000)).
Por conseguinte, a presente invenção contempla métodos para tratar ou prevenir cânceres metastáticos por identificação das lesões pré- invasivas ou carcinomas em pacientes, e tratar o paciente para eliminar a lesão pré-invasiva antes que ela tenha a oportunidade de evoluir para uma forma invasiva. Tais métodos compreendem, por exemplo, (a) obter uma amostra de tecido que é suspeita de conter um câncer ou uma lesão pré- invasiva, e uma amostra de tecido que não contém nem câncer nem lesão pré-invasiva (preferivelmente do mesmo tecido ou órgão que aquele suspeito de conter câncer ou lesão pré-invasiva); (b) contatar as amostras de tecido com um ou mais ligantes de ligação de ανββ, tais como um ou mais anticorpos de ligação de ανββ ou fragmentos destes, sob condições que favoreçam a ligação do um ou mais ligantes de ligação de ανββ às integrinas Ονββ no qualquer que seja o tecido presente; e (c) detectar o nível ou padrão de ligação do(s) ligante(s) de ligação de ανββ ao tecido, em que um aumento da ligação localizada do ligante de ligação de ανββ no mioepitélio que circunda uma hiperplasia (por exemplo, um tumor) com relação à ligação na própria hiperplasia (ou células desta), ou um aumento do nível de ligação do ligante de ligação de αν β na amostra de tecido contendo a lesão cancerosa ou pré-invasiva com relação à ligação na amostra de tecido não canceroso (ou células deste), é indicativo de carcinoma que é mais provável de se tornar invasivo e potencialmente metastatizar. Em outras modalidades relacionadas, a invenção contempla métodos para reduzir ou prevenir a progressão de um tumor pré-metastático ou pré-invasivo para um-tumor metastático ou invasivo em um paciente, compreendendo a administração ao paciente de uma quantidade terapeuticamente eficaz de um ou mais ligantes que se ligam a uma ou mais subunidades de integrina ανββ em uma ou mais células no tumor pré-metastático ou pré-invasivo, em que a ligação do ligante à integrina resulta na redução ou prevenção de uma invasão de células do câncer pré-metastático ou pré-invasivo em áreas teciduáis que circundam o tumor primário.
Tecidos e órgãos adequados dos quais as amostras podem ser obtidas para uso de acordo com estes métodos da invenção incluem, mas sem limitação, os tecidos epiteliais descritos em algum lugar aqui. Cânceres e tumores que podem ser vantajosamente tratados ou prevenidos de acordo com tais métodos da invenção incluem, mas não são necessariamente limi- tados a, carcinomas, particularmente adenocarcinomas, incluindo os carcinomas e adenocarcinomas descritos em detalhes em algum lugar aqui. Uma vez que um carcinoma tenha sido detectado de acordo com os métodos da invenção, ele pode ser então eliminado do paciente por meio de cirúrgica, quimioterapêutica, radiológica ou outros métodos de terapia de câncer que são bem-conhecidos da técnica e que, portanto, serão familiares àqueles versados. Alternativamente, tal carcinoma pode ser eliminado usando os métodos de tratamento da presente invenção, por administração ao paciente, ou aos órgãos ou tecidos do paciente, de um ou mais ligantes de ligação de Ονββ» tal como um ou mais anticorpos de ligação de Ovp6 .pu fragmentos destes. Em certos exemplos não limitativos de tais modalidades, o um ou mais ligantes de ligação de θνββ foram conjugados com um ou mais compostos ou agentes citotóxicos conforme descrito em detalhes acima. Em exemplos não limitativos adicionais de tais modalidades, o um ou mais ligantes de ligação de νββ, tal como um ou mais anticorpos de ligação de Ονββ ou fragmentos destes, são administrados a um indivíduo, tal como um paciente, em conjunto com um ou mais compostos ou agentes citotóxicos conforme descrição detalhada acima.
Em modalidades relacionadas, a invenção contempla determinar o potencial metastático de um tumor ou célula cancerosa por medição da expressão de θνβ6 pelo tumor ou célula cancerosa. Em tais modalidades, as amostras de tumor ou célula são obtidas de um paciente conforme descrição acima e são ensaiadas de acordo com os métodos descritos aqui para o nível de expressão de θνββ no tumor ou célula cancerosa. Tais métodos preferidos incluem imunoistoquímica, usando anticorpos de ligação de θνβ6 (ou fragmentos, variantes ou derivados destes), tais como aqueles descritos a-qui. De acordo com esses métodos da invenção, há uma correlação direta entre o nível de expressão de ο βε pelo tumor ou célula cancerosa e o potencial metastático do tumor ou célula cancerosa: um aumento da expressão de Ονββ por um tumor ou célula cancerosa indica que aquele tumor ou célula cancerosa é provável de metastatizar para um local secundário do sítio de tumor primário. Logo, o nível de expressão de ο^,βε por um tumor ou célula cancerosa pode ser usado como um indicador prognóstico do potencial me- tastático de um tumor ou célula cancerosa, que pode auxiliar pacientes com câncer e seus médicos a tomar as decisões apropriadas de tratamento com base na presente ou futura agressividade ou invasividade, prevista, do câncer.
Além de ensaiar níveis de expressão de ανβε em uma amostra biológica obtida de um indivíduo, tal como uma amostra de tecido ou de célula tumoral, o nível e padrão de expressão de ανββ podem ser também detectados in vivo por imageamento. Em tais métodos da invenção, um ou mais ligantes de ligação de ανββ. por exemplo, um ou mais anticorpos de ligação de ανβ6, são detectavelmente marcados com um ou mais rótulos a dequados para imageamento in vivo. Rótulos ou rótulos adequados para imageamento in vivo incluem aqueles detectáveis por radiografia X, RMN ou ESR. Para radiografia X, os rótulos incluem radioisótopos tais como bário e césio, que emitem radiação detectável, mas não são manifestamente prejudiciais ao paciente. Rótulos adequados para RMN e ESR incluem aqueles com spin característico detectável tal como deutério.
Um ligante se ligando a ανβε, por exemplo, um anticorpo de ligação de θνββ ou anticorpo deste, que tenha sido marcado com uma porção de imageamento detectável apropriada, tal como um radioisótopo (por exemplo, 311, 12ln, 99mTc), uma substância radiopaca, ou um material detectável por ressonância magnética nuclear, é introduzida (por exemplo, via pârenteral, subcutânea ou intraperitoneal) no mamífero a ser examinado para câncer ou carcinoma in situ. Será entendido na técnica que o tamanho do paciente e o sistema de imageamento usado determinarão a quantidade da porção de imageamento necessária para produzir imagens para diagnóstico. No caso de uma porção de radioisótopo, para um paciente humano, a quantidade de radioatividade injetada variará normalmente de cerca de 5 a 20 milicuries de 99cTc. O ligante de θνβ6 marcado, por exemplo, anticorpo ligação de ανββ ou fragmento de anticorpo, acumular-se-á preferencialmente no local das células ou tecidos que contêm ou expressam integrina Ονββ- O imageamento de tumor in vivo é então obtido como descrito por S.W. Burchiel et al., "Immu-nopharmacokinetics of Radiolabelled Antibodies and Their Fragments" (Ca- pítulo 13 em Tumor Imaging: The Radiochemical Detection of Câncer, S.W. Burchiel e B.A. Rhodes, eds. Masson Publishing Inc. (1982)).
Usos Terapêuticos dé Liqantes de Ligação de OL K
Em modalidades adicionais da invenção, ligantes de ligação de ονββ, tais como anticorpos de ligação de ανββ ou fragmentos destes, podem ser usados em regimes terapêuticos para tratar animais afligidos com certas doenças, particularmente com certos carcinomas tais como aqueles descritos em algum lugar aqui. Tais métodos da invenção são úteis para tratar câncer e eventos associados, incluindo crescimento de tumor, metástase e angiogênese. Particularmente receptivos a tal tratamento são aquelas doenças ou cânceres que são caracterizados por níveis aumentados de expressão de Ονββ nos tecidos ou células de um mamífero que sofre da doença e que são responsivos aos tratamentos que alvejam os tecidos ou células que expressam elevados níveis de Ονββ e eliminam aqueles tecidos ou células. Doenças que são particularmente tratáveis por esses métodos incluem cânceres metastáticos de tecidos epiteliais (isto é carcinomas metastáticos e/ou adenocarcinomas), incluindo mama, ovário, próstata, fígado, pulmão, pâncreas, cólon, tecidos da cabeça e do pescoço (por exemplo, tecidos orais, faríngeos, linguais e laríngeos), endométrio, cérvice, estômago e baço. Par-ticularmente adequados para o tratamento por esses métodos da presente invenção são carcinomas do endométrio, pâncreas, cólon (por exemplo, carcinomas colorretais), cérvice, pulmão e mama (incluindo carcinoma ductal in situ (DCIS) e carcinoma lobular in situ (LCIS) da mama). Mamíferos preferidos para tratamento incluem macacos, gatos, cachorros, vacas, porcos, ca-valos, coelhos e seres humanos. Particularmente preferidos são os seres humanos.
Em certas de tais regimes terapêuticos, os métodos da invenção são adequados para eliminar células tumorais residuais, por exemplo, de células metastáticas residuais, seguinte à remoção, tratamento ou erradica-ção de um tumor por uma abordagem diferente. Por exemplo, tais métodos da invenção podem ser usados para eliminar células tumorais residuais ou células metastáticas que podem permanecer no paciente seguinte à excisão cirúrgica de um tumor, ou erradicação do tumor por métodos tais como irradiação, quimioterapia e similares. Em tais regimes terapêuticos, os métodos da invenção podem compreender administrar os ligantes de ligação de Ονββ, por exemplo, os anticorpos de ligação de θνβ6 ou fragmentos destes, a um paciente antes, durante, e/ou seguinte à ablação cirúrgica, radiológica e/ou quimioterapêutica do tumor.
Em modalidades relacionadas, como descritas acima, a invenção proporciona métodos para reduzir ou prevenir a progressão de um tumor pré-metastático para um tumor metastático em um paciente, compreendendo administrar ao paciente uma quantidade terapeuticamente eficaz de um ou mais ligantes que se ligam a uma ou mais subunidades de integrina ανββ em uma ou mais células no tumor pré-metastático, em que a ligação do ligante à integrina resulta na redução ou prevenção da invasão de células do câncer pré-metastático nas áreas de tecido que circundam o tumor primário.
Ao efetuar esses métodos terapêuticos da invenção, os ligantes de ligação de θνββ, tais como anticorpos de ligação de Ονββ ou fragmentos destes, podem ser administrados aos pacientes na forma de formulações terapêuticas (que são também aqui referidas de modo intercambiável e equivalente como composições farmacêuticas). As formulações terapêuticas dos ligantes de ligação de ανβ6 usados de acordo com a presente invenção são preparados para armazenagem por mistura de um ligante de ligação de ο ββ tendo o grau desejado de pureza com veículos, excipientes ou estabilizan-tes, opcionais, farmaceuticamente aceitáveis (Remington's Pharmaceutical Sciences, 16a Edição, Osol, A. Ed. (1980)), por exemplo, na forma de formulações liofilizadas ou soluções aquosas. Além dos compostos farmacologicamente ativos tais como os ligantes de ligação de ανββ, as composições usadas nos métodos terapêuticos da invenção podem conter um ou mais veículos farmaceuticamente aceitáveis compreendendo excipientes e auxiliares que facilitam o processamento dos compostos ativos nas preparações que podem ser usadas farmaceuticamente. As preparações farmacêuticas da presente invenção são fabricadas em um modo que é conhecido per se, por exemplo, por meio de processos convencionais de misturamento, granu- lação, fabricação de drágeas, dissolução, ou liofilização. Assim, as preparações farmacêuticas para uso oral podem ser obtidas por combinação dos compostos ativos com excipientes sólidos, triturando, opcionalmente, a mistura resultante e processando a mistura de grânulos, depois de adicionar auxiliares adequados, se desejado ou necessário, para obtenção de comprimidos ou núcleos de drágeas.
Excipientes adequados são, em particular, cargas tais como sa-carídeos, por exemplo, lactose ou sacarose, manitol ou sorbitol, preparações de celulose e/ou fosfatos de cálcio, por exemplo, fosfato de tricálcio ou hi-drogeno-fosfato de cálcio, bem como ligantes, tal como pasta de amido, u-sando, por exemplo, amido de milho, amido de trigo, amido de arroz, amido de batata, gelatina, tragacanto, metil celulose, hidroxipropil metilcelulose, carboximetilcelulose sódica, e/ou polivinil pirrolidona. Se desejado, agentes desintegradores podem ser adicionados, tais como os amidos mencionados acima e também carboximetil-amido, polivinil pirrolidona reticulada, ágar, ou ácido algínico ou um sal deste, tal como alginato de sódio. Auxiliares são, acima de tudo, agentes reguladores de fluxo e lubrificantes, por exemplo, sílica, talco, ácido esteárico ou sais destes, tais como estearato de magnésio ou estearato de cálcio, e/ou polietileno glicol. Núcleos de drágeas são proporcionados com revestimentos adequados, que, se desejado, são resistentes aos sucos gástricos. Com essa finalidade, soluções concentradas de sa-carídeo podem ser usadas, que podem conter opcionalmente goma arábica, talco, polivinil pirrolidona, polietileno glicol, e/ou dióxido de titânio, soluções de laca e solventes orgânicos adequados ou misturas de solventes. De modo a produzir revestimentos resistentes aos sucos gástricos, soluções de preparações de celulose adequadas, tal como ftalato de acetilcelulose ou ftalato de hidroxipropilmeticelulose, são usadas. Produtos corantes ou pigmentos podem ser adicionados aos comprimidos ou revestimentos de drá-gea, por exemplo, para identificação ou de modo a caracterizar combinações de doses de compostos ativos.
Outras preparações farmacêuticas que podem ser usadas oralmente incluem cápsula de encaixe por pressão feitas de gelatina, bem como cápsulas moles vedadas feitas de gelatina e um plastificante tal como glice- rol õu sorbitol. As cápsulas de encaixe por pressão podem conter os compostos ativos na forma de grânulos que podem ser misturados com cargas tal como lactose, aglutinantes tais como amidos, e/ou lubrificantes tal como talco ou estearato de magnésio e, opcionalmente, estabilizantes. Nas cápsulas macias, os compostos ativos são preferivelmente dissolvidos ou suspensos em líquidos adequados tais como óleos graxos ou parafina líquida. Além disso, estabilizantes podem ser adicionados.
Formulações adequadas para administração parenteral incluem soluções aquosas dos compostos ativos em forma solúvel em água, por e-xemplo, sais solúveis em água e soluções alcalinas. Sais alcalinos podem incluir sais de amónio preparados, por exemplo, com Tris, hidróxido de colina, bis-Tris-propano, N-metilglucamina, ou arginina. Além disso, podem ser administradas suspensões dos compostos ativos como suspensões para injeção oleosa, apropriadas. Solventes ou veículos lipofílicos adequados incluem óleos graxos, por exemplo, óleo de gergelim, ou ésteres de ácidos graxos sintéticos, por exemplo, oleato de etila ou triglicerídeos ou polietileno glicol-400 (os compostos são solúveis em PEG-400). Suspensões de injeção aquosa podem conter substâncias que aumentam a viscosidade da suspensão, por exemplo, carboximetil celulose sódica, sorbitol e/ou dextrano. Opcionalmente, a suspensão pode também conter estabilizantes.
Os compostos da presente invenção podem ser administrados ao olho em animais e seres humanos como gotas, ou dentro de unguentos, géis, lipossomas, ou discos de polímero biocompatível, péletes ou transportados em lentes de contato. A composição intraocular pode conter também um veículo oftálmico fisiologicamente compatível conforme aqueles versados na técnica podem selecionar usando critérios convencionais. Os veículos podem ser selecionados dos veículos oftálmicos conhecidos, que incluem, mas sem limitação, água, poliéteres tal como polietileno glicol 400, polivinilas tais como poli(álcool vinílico), povidona, derivados de celulosé tais como carboximetilcelulose, metilcelulose e hidroxipropil metilcelulose, derivados de petróleo tais como óleo mineral e petrolato branco, gorduras animais tal co- mo lanolina, gorduras vegetais, tal como óleo de amendoim, polímeros de ácido acrílico tal como gel de carboxilpolimetileno, polissacarídeos tais como dextranos e glicosaminaglicanos tais como cloreto de sódio e cloreto de potássio, cloreto de zinco e tampão tal como bicarbonato de sódio ou lactato de sódio. Moléculas de alto peso molecular podem também ser usadas. Conservantes fisiologicamente compatíveis, que não inativam os compostos da presente invenção na composição incluem álcoois tal como clorobutanol, cloreto de benzalcônio e EDTA ou qualquer outro conservante apropriado conhecidos daqueles versados na técnica.
Formulações liofilizadas de anticorpos adaptadas para administração subcutânea estão descritas na Patente 6.267.958, cuja descrição é aqui incorporada a título de referência em sua totalidade. Tais formulações liofilizadas podem ser reconstituídas com um diluente adequado para uma alta concentração de proteína e a formulação reconstituída pode ser admi-nistrada subcutaneamente ao paciente a ser tratado aqui.
Os ligantes de ligação de Ονββ podem ser também embutidos em microcápsulas preparadas, por exemplo, por técnicas de coacervação ou por polimerização interfacial, por exemplo, microcápsulas de hidroximetilcelulose ou de gelatina e microcápsulas de poli(metacrilato de metila), respectiva-mente, em sistemas de distribuição de fármacos coloidais (por exemplo, li-possomas, microesferas de albumina, microemulsões, nanopartículas e na-nocápsulas) ou em macroemulsões. Tais técnicas são descritas na Reming-ton's Pharmaceutical Sciences, 16- Edição, Osol, A. Ed. (1980).
Preparações de liberação constante com ligantes de ligação de θν β podem ser preparadas. Exemplos adequados de preparações de liberação constante incluem matrizes semipermeáveis de polímeros hidrofóbicos sólidos contendo o ligante de ligação de θνββ, cujas matrizes estão na forma de artigos conformados, por exemplo, filmes, ou microcápsulas. Exemplos de matrizes de liberação constante incluem poliésteres, hidrogéis (por exem-pio, poli(metacrilato de 2-hidroxietila), ou poli(álcool vinílico)), polilactídeos (Patente US 3.773.919), copolímeros de ácido L-glutâmico e L-glutamato de γ-etila; etileno-acetato de vinila não degradável, copolímeros de ácido láctico- ácido glicolico degradáveis, tal como LUPRON DEPOT® (microesferas inje- táveis compostas de copolímero de ácido láctico-ácido glicolico e acetato de leuprolídeo), e poli(ácido D-(-)-3-hidroxibutírico.
As formulações a serem usadas na administração in vivo devem ser estéreis. Isso é prontamente obtido por filtração através de membranas de filtração estéreis.
O ligante de ligação de ο ββ pode ser administrado ao indivíduo ou paciente por quaisquer meios adequados, incluindo, parenteral, intrapul-monar, intracraniano, transdérmico e intranasal. Infusões parenterais incluem administração intramuscular, intravenosa, intra-arterial, intraperitoneal, ou subcutânea. Além disso, o ligante de ligação de Ονββ pode ser adequadamente administrado por infusão pulsada, por exemplo, com doses declinantes do ligante de ligação de θνβ6· Preferivelmente, a dosagem é dada por injeções, mais preferivelmente por injeções intravenosas ou subcutâneas, dependendo em parte de se a administração é breve ou crónica.
Em certos exemplos de modalidades da invenção, os ligantes de ligante de ανββ são administrados ao paciente (por exemplo, intravenosa-mente) em uma dosagem de entre cerca de 1 mg/m2 e cerca de 500 mg/m2. Por exemplo, o ligante de ligação de ανβε pode ser administrado em uma dosagem de cerca de 1 mg/m2, 2 mg/m2, 3 mg/m2, 4 mg/m2, 5 mg/m2, 10 mg/m2, 15 mg/m2, 20 mg/m2, 25 mg/m2, 30 mg/m2, 35 mg/m2, 40 mg/m2, 45 mg/m2, 50 mg/m2, 55 mg/m2, 60 mg/m2, 65 mg/m2, 70 mg/m2, 75 mg/m2, 80 mg/m2, 85 mg/m2, 90 mg/m2, 95 mg/m2, 100 mg/m2, 105 mg/m2, 110 mg/m2, 115 mg/m2, 120 mg/m2, 125 mg/m2, 130 mg/m2, 135 mg/m2, 140 mg/m2, 145 mg/m2, 150 mg/m2, 155 mg/m2, 160 mg/m2, 165 mg/m2, 170 mg/m2, 175 mg/m2, 180 mg/m2, 185 mg/m2, 190 mg/m2, 195 mg/m2, 200 mg/m2, 205 mg/m2, 210 mg/m2, 215 mg/m2, 220 mg/m2, 225 mg/m2, 230 mg/m2, 235 mg/m2, 240 mg/m2, 245 mg/m2, 250 mg/m2, 255 mg/m2, 260 mg/m2, 265 mg/m2, 270 mg/m2, 275 mg/m2, 280 mg/m2, 285 mg/m2, 290 mg/m2, 295 mg/m2, 300 mg/m2, 305 mg/m2, 310 mg/m2, 315 mg/m2, 320 mg/m2, 325 mg/m2, 330 mg/m2, 335 mg/m2, 340 mg/m2, 345 mg/m2, 350 mg/m2, 355 mg/m2, 360 mg/m2, 365 mg/m2, 370 mg/m2, 375 mg/m2, 380 mg/m2, 385 mg/m2, 390 mg/m2, 395 mg/m2 ou 400 mg/m2.
O ligante de ligação de ανββ pode ser administrado de acordo com uma ampla variedade de esquemas de dosagem. Por exemplo, o ligante de ligação de Ονββ pode ser administrado uma vez ao dia por uma quantidade predeterminada de tempo (por exemplo, quatro a seis semanas, ou mais), ou de acordo com um esquema semanal (por exemplo, um dia por semana, dois dias por semana, três dias por semana, quatro dias por semana, cinco dias por semana, seis dias por semana ou sete dias por semana) por uma quantidade predeterminada de tempo (por exemplo, de quatro a oito semanas, ou mais). Um exempJo específico de um esquema de dosagem "uma vez por semana" é a administração do ligante de ligação de θνβ6 nos dias 1 , 8, 15 e 22 do período de tratamento. Em modalidades alternativas, o ligante de ligação de ο βθ pode ser administrado intermitentemente por um período de meses. Por exemplo, o ligante de ligação de ανββ pode ser administrado semanalmente por três semanas consecutivas bianualmente (isto é, repetir o esquema de dosagem semanal a cada seis semanas). Será apreciado que tais regimes de administração podem ser continuados por prolongados períodos (da ordem de anos) para manter efeitos terapêuticos benéficos proporcionados pelos tratamentos iniciais. Em ainda outras modalidades, tal terapia de manutenção pode ser efetuada seguindo um regime de dosagem agudo planejado para reduzir os sintomas imediatos da condição cancerosa, metastática ou de carcinoma in situ.
A quantidade de ligante de ligação de ανββ administrada de cada vez por todo o período de tratamento pode ser a mesma; alternativamente, a quantidade administrada de cada vez durante o período de tratamento pode variar (por exemplo, a quantidade administrada em um dado tempo pode ser maior ou menor que a quantidade administrada previamente). Por exemplo, doses dadas durante a terapia de manutenção podem ser menores que a-quela administrada durante a fase aguda do tratamento. Esquemas de dosagem apropriados dependendo das circunstâncias específicas serão aparentes para aqueles versados na técnica.
Em certas modalidades da invenção, múltiplos tipos ou espécies de ligantes de ligação de θνβ6 são combinados com uns com os outros e administrados a um paciente para tratar uma ou mais condições cancerosas, metastáticas óu de carcinoma in situ. Por exemplo, a invenção contempla a administração de dois ou mais diferentes anticorpos de ligação de θνβ6 a um paciente, tais como aqueles descritos aqui. Quando ligantes de ligação de ανββ múltiplos são administrados a um paciente, os ligantes de ligação de Ον β diferentes podem ser administrados juntos em uma única composição farmacêutica, ou, mais preferivelmente, podem ser administrados sequencialmente em dosagens separadas. A quantidade eficaz de tais outros agentes depende da quantidade de ligantes de ligação de ανββ presente na formulação, o tipo de doença ou distúrbio ou tratamento, e outros fatores.
A presente invenção inclui também métodos para tratar condições cancerosas, metastáticas ou de carcinoma in situ que compreendem administrar a um paciente um primeiro agente em conjunto com um segundo agente, em que o primeiro agente é um ligante de ligação de ο ββ e o segundo agente é um agente que é útil para tratar uma ou mais condições cancerosas, metastáticas ou de carcinoma in situ, mas que não é necessariamente um ligante de ligação de ανββ· Por administrar um primeiro agente "em conjunto com" um segundo agente deve ser entendido que o primeiro agente pode ser administrado ao paciente antes de, simultaneamente com, ou após, administrar o segundo agente ao paciente, de modo que ambos os agentes são administrados ao paciente durante o regime terapêutico. Por exemplo, de acordo com certas de tais modalidades da invenção, um ligante de ligação de Ονββ é administrado a um paciente em conjunto, isto é antes, simultaneamente com, ou após a administração de um antagonista de um ou mais receptores de integrina (por exemplo, αιβ-ι , αφι, ανββ, ανβδ, ο¾βι, etc.) ao paciente, incluindo anticorpos, antagonistas de polipeptídeo e/ou antagonistas de pequenas moléculas específicos para um ou mais receptores de integrina (por exemplo, αιβι, ο^βι, ανββ, Ονβδ, θδβι, etc), que são conhecidos na técnica.
Em certas modalidades desse aspecto da invenção, o segundo agente que é administrado em conjunto com um ligante de ligação de θνβ6 é, por exemplo, um esferóide, um composto citotóxico (incluindo aqueles descritos em algum lugar aqui), um radioisótopo (incluindo aqueles descritos em algum lugar aqui), uma enzima ativadora de pró-fármaco (incluindo aqueles descritos em algum lugar aqui), colchicina, oxigénio, um antioxidante (por exemplo, N-acetilcisteína), um quelador de metal (por exemplo, tetratiomo- libdato), IFN-β, IFN-γ, alta-antitripsina e similares. Segundos agentes ou compostos adicionais que podem ser administrados a um paciente em conjunto com um ou mais primeiros agentes, tais como um ou mais ligantes de ligação de ανββ, para fins terapêuticos, de acordo com este aspecto da in-venção, serão familiares àqueles versado na técnica; o uso de tais segundos agentes ou compostos adicionais é, portanto, considerado como sendo englobado pela presente invenção.
Serão prontamente aparentes para aquele versado nas técnicas relevantes que outras modificações ou adaptações aos métodos e aplica-ções descritos aqui são óbvias e podem ser efetuadas sem se desviar do escopo da invenção ou de qualquer modalidade desta. Tendo agora descrito a presente invenção em detalhes, a mesma será mais claramente entendida por referência aos seguintes exemplos, que são incluídos aqui com os propósitos somente de ilustração e não têm o objetivo de limitar a invenção. Exemplos
Exemplos 1 : Clonagem das Regiões Variáveis de mu3G9 - RNA celular total de células de hibridoma murino 3G9 foi preparado usando-se o mini-kit Qiagen RNeasy seguindo o protocolo recomendado pelo fabricante. DNA complementar que codifica as regiões variáveis das cadeias pesadas e leves foi clonado por RT-PCR do RNA celular total usando o kit First Strand cDNA Synthesis Amersham/Pharmacia seguindo o protocolo recomendado pelo fabricante, usando hexâmeros aleatórios para sensibilização.
Os iniciadores usados para amplificação por PCR do domínio de cadeia variável pesada de imunoglobulina de 3G9 foram:
5' AGGTCTAGAAYCTCCACACACAGGRRCCAGTGGATAGAC 3' (SEQ ID NO: 8); 5' GGGGATATCCACCATGRACTTCGGGYTGAGCTKGGTTTT 3' (SEQ ID NO: 9); (S=C/G, M=A G, R=A/G, K=G T, W=A/T, e Y=CT) .
A reação consistiu em uma fusão inicial a 95°C, por 2,5 minutos, seguido por 10 ciclos de fusão a 94°C, por 30 segundos, anelando a 60°C menos 1 °C por ciclo, por 45 segundos, e elongação a 68°C, por 1 minuto usando a Advantage Taq DNA polimerase da Clontech. A reação continuou por 10 ciclos adicionais de fusão a 94°C, por 30 segundos, anelando a 55°C por 45 segundos, elongação a 68°C por 1 minuto, e uma elongação final de

9 minutos, a 68°C. As reações foram purificadas usando o kit de purificação por PCR Qiagen Qiaquick seguindo o protocolo do fabricante. As extremidades do DNA amplificado por Advantage Taq foram polidos para gerar extremidades cegas com 17 DNA polimerase em presença de excesso de dNTPs. Os produtos de PCR de gene de região variável de cadeia pesada de 3G9 purificados e cegos foram subclonados em um vetor de clonagem pCR4Blunt-TOPO da Invitrogen usando seu kit de clonagem TOPO seguindo o protocolo recomendado pelo fabricante. Os subclones de RT-PCR da cadeia pesada foram designados pKJS062.
O gene de domínio variável da cadeia pesada de 3G9 foi amplificado com os iniciadores:
5' GCGTCTAGAACTGGATGGTGGGAGATGGA 3' (SEQ ID NO: 10);
5' GGGGATATCCACCATGGATTTTCAGGTGCAGATTTTCAG S' (SEQ ID

NO: 11).
A reação consistiu em uma fusão inicial a 95°C, por 2,5 minutos, seguido por 6 ciclos de fusão a 94°C, por 30 segundos, anelando a 60°C menos 1 °C por ciclo, por 45 segundos, e elongação a 68°C, por 2 minutos usando a Advantage Taq DNA polimerase da Clontech. A reação continuou por 24 ciclos adicionais de fusão a 94°C, por 30 segundos, anelando a 54°C por 45 segundos, elongação a 68°C, por 2 minutos e uma elongação final de

10 minutos a 68°C. Um décimo da reação foi usada como um modelo por um segundo ciclo de amplificação com Pfu DNA polimerase (Stratagene). A reação consistiu em uma fusão inicial a 95°C, por 2,5 minutos, seguida por 20 ciclos de fusão a 94°C, por 30 segundos, anelando a 55°C, por 45 segundos, e elongação a 72°C, por 1 minuto. Os produtos de reação compreendi- am gel purificado usando o kit de extração de gel Qiagen Qiaquick seguindo o protocolo recomendado pelo fabricante. Os produtos de PCR de gene de região variável da cadeia leve de 3G9 purificados foram subclonados em vetor de clonagem de pCR4Blunt-TOPO da Invitrogen usando seu kit de clonagem TOPO. Os subclones de RT-PCR da cadeia leve foram designados pKJS054.
Inserções provenientes de subclones independentes múltiplos de ambos pKJS054 e pKJS062 foram sequenciados. Em ambos os casos, as sequências de inserções dos subclones independentes múltiplos eram idênticos. Análises Blast das sequências de domínios variáveis confirmaram sua identidade de imunoglobulina. O domínio variável da cadeia pesada de 3G9 é um membro do subgrupo IIID murino. A região variável de cadeia leve de 3G9 é um membro do subgrupo IV kappa murino.
Exemplo 2: Construção e Expressão de ch3G9
cDNAs que codificam as regiões variáveis de 3G9 murino das cadeias pesas e leves foram usados para construir vetores para expressão de quimeras murino-humanas (ch3G9), nas quais as regiões variáveis de mu3G9 foram ligadas à lgG1 humano e regiões constantes kappa.
Para construção da quimera de cadeia pesada, o fragmento de EcoRI de 508 bp proveniente do plasmídio pKJS062 de domínio variável da cadeia pesada de 3G9 foi subclonado no sítio EcoRI do vetor de clonagem pNN09 derivado de pUC desfosforilado, linearizado. Essa etapa adicionou sítios Notl flanqueadores no plasmídio resultante, pKJS093. A sequência de cadeia pesada no plasmídio pKJS093 foi confirmada por sequenciamento de DNA. O sítio doador de fatia seguido imediatamente por um sítio de restrição Hindlll foi adicionado ao plasmídio pKJS093 imediatamente a jusante da sequência de codificação de regiões variáveis por mutagênese direcionada a sítio com oligonucleotídeos mutagênicos:
5' CTGTCTCTG C AG GTAAGCTTAC ACCCCC ATCTG 3' (SEQ ID NO: 12), 5' CAGATGGGGGTGTAAGCTTACCTGCAGAGACAG 3' (SEQ ID NO: 13) usando kit de mutagênese Quickchange da Stratagene seguindo o protocolo recomendado pelo fabricante. Essa etapa gerou o plasmídio pKJS1 16. O fragmento de domínio variável da cadeia pesada de Notl-Hindlll de 0,48 kb desvio padrão pKJS1 16 e o fragmento de Hindlll-Notl de 1 ,22 kb do plasmí-dio pEAG964, contendo uma região constante de lgG1 humano, foram sub-clonados no sítio Notl do plasmídio pCH269 derivado do vetor de expressão EBV (Invitrogen) de pCEP4, produzindo o plasmídio pKJS136.
Para construção da quimera de cadeia leve, o fragmento de E-coRi de 474 pares de base do plasmídio pKJS054 de domínio variável de cadeia leve de 3G9 foi subçlonado no sítio EcoRI do vetor de clonagem pNN09 desfosforilado, linearizado adicionando sítios Notl flanqueadores no plasmídio resultante, pKJS1 12. A sequência de cadeia leve no plasmídio pKJS1 2 foi confirmada por sequenciamento de DNA. Um sítio de restrição Bglll foi adicionado ao plasmídio pKJS1 12 imediatamente a jusante da sequência de codificação de região variável por mutagênese direcionada por sítio com oligonucleotídeos mutagênicos:
5' G G C ACC A AG CTG G AG ATCT A ACG G G CTG ATG CTG C 3' (SEQ ID NO: 14), 5' GCAGCATCAGCCCGTTAGATCTCCAGCTTGGTGCC 3' (SEQ ID NO: 15) usando o kit de mutagênese Quickchange da Stratagene gerando o plasmídio pKJS132, O fragmento de domínio variável de cadeia leve de Notl-Bglll de 453 bp do pKJS132 e o fragmento de Beíl-Notl de 678 bp do plasmídio pEAG963 contendo um domínio constante da cadeia leve kappa humano, foram subclonados no sítio Notl do plasmídio pCH269 derivado do vetor de expressão EBV (Invitrogen) de pCEP4, produzindo o plasmídio pKJS141. Foi observado durante a clonagem de mu3G9 que a primeira CDR da cadeia leve continha uma sequência de sinais de glicosilação (NXT S). Um único ciclo de mutagênese direcionada a sítio Quickchange com os oligonucleotídeos:
5' GGAACTTACACTTGAGCTGGCACTGCATGTCAAGG 3' (SEQ ID NO: 16), 5* CCTTGACATGCAGTGCCAGCTCAAGTGTAAGTTCC 3' (SEQ ID NO: 17), convertendo o motivo NSS em SSS e criando o vetor de expressão pKJS157, removeu essa sequência de sinais de glicosilação. A sequência de regiões variáveis da cadeia leve de pKJS157 foi confirmada por sequenciamento de DNA.

Os vetores de expressão (pKJS141 ou pKJS157 da cadeia leve e pKJS136 da cadeia pesada) foram co-transfectados nas células 293-EBNA e as células transfectadas foram testadas quanto à secreção e especificidade de anticorpo. Células transfectadas com o vetor vazio e as células co- transfectadas com vetores de expressão EBV para chM92 (um mAb específico de CD154 molecularmente clonado) serviram como controles. Análise de título de anticorpos, usando o kit Easy Titer de Pierce, seguindo o protocolo recomendado pelo fabricante, e análise Western blot (desenvolvida com anticorpos de cadeias pesadas e cadeias leves anti-humanas) de meios condicionados indicaram que as células transfectadas de ch3G9 sintetizaram e montaram eficazmente cadeias pesadas e leves e secretaram anticorpo. Um ensaio ELISA contra θν 6 demonstrou que ch3G9 ligou a θνβ6 similarmente a mu3G9 enquanto chM92 não.
Como mostrado na figura 1 , 3G9 quimérico (ch3G9; indicado pelo símbolo triangular) e uma forma mutante aglicosila do 3G9 quimérico contendo uma substituição N para S dentro de um sítio de glicosilação ligado a N na primeira CDR da cadeia leve (ch3G9S; indicado pelo símbolo quadrado) produzidos de transfecções transitórias em larga escala foram purificados e demonstraram similar ligação a ανβε em um ensaio ELISA. A remoção do sítio de glicosilação dentro da CDR1 do domínio variável de cadeia leve mostrou que aperfeiçoa a expressão e purificação de proteína sem alterar ou afetar a afinidade de ligação do anticorpo.
Exemplo 3: Construção das versões 1 , 2 & 3 de hu3G9
O desenho dos domínios variáveis reconformados para produzir 3G9 humanizado (hu3G9) foi feito como a seguir. O domínio variável da cadeia leve de 3G9 corresponde a kappa 3 humano, e o domínio variável de cadeia pesada corresponde ao subgrupo 3 pesado humano. A escolha das estruturas de aceptor humano foi por emparelhamento de homologia com sequências de germe-linha humana usando o programa IgBLAST: L6 humana (com a região J derivada de JK4 humano) para a cadeia leve e 3-7 humanas (com a região J derivada de JH4 humano) para a cadeia pesada. Três versões de cada uma das cadeias leves e pesadas variáveis, reconfor- madas, foram desenhadas conforme mostradas na Tabela 1. A primeira versão contém a maioria da retromutações para as sequências doadoras muri- no, enquanto a terceira versão contém a minoria (isto é as mais "humanizadas"). As regiões de CDR dos domínios variáveis das cadeias pesadas e leves, conforme mostradas na Tabela I, abaixo, estão sendo definidas pelo sistema de classificação de numeração de Kabat, convencional. Contudo, a numeração das seqúências é representada com base no posicionamento linear relativo das diferentes sequências com respeito uma às outras.
TABELA 1 - Seqúências de Cadeias Pesadas e Leves para hu3G9
Tabela 1 a - Seqúências de Cadeias Pesadas
FR1 s FR2
Murino ( I ) EV MLVESGGGLV KPGGSL LSCA ASGFTFS RYVMS WV RQTPE RLEW V A

3G9HV 1 ( 1 ) EVMLVESGGGLVQPGGSLRLSCAASGFTFS RYV S WVRQAPG GLEWVA

3G9HV2 ( 1 ) EVQLVESGGGLVQPGGSLRLSCAASGFTFS RYVMS WVRQAPGKGLEWVA

3G9HV3 (1 ) EVQLVESGGGLVQPGGSLRLSCAASGFTFS RYVMS WVRQAPGKGLEWVA

VH3-7 (1 ) EVQLVESGGGLVQPGGSLRLSCAASGFTFS WVRQAPGKGLEWVA

CDR2 FR3
Murine (50) SISS-GGRMYYPDTVKG RFTI S RDS ARNIL YLQM S S LRS EDT AM Y YC AR 3G9HV1 (50) SISS-GGRMYYPDTVKG RFT1SRDSAKNSLYLQMNSLRAEDTAVYYCAR 3G9HV2 (50) SISS-GGRMYYPDTVKG RFTISRDSAKNSLYLQMNSLRAEDTAVYYCAR 3G9HV3 (50) SISS-GGRMYYPDTVKG RFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR VH3-7 (50) -RFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR
Tabela 1 b - Seqúências de Cadeias Leves
FR1 CDR1 FR2
Murino (D QIVLTQSPAIMSASPGEKVTLTC SANSSVSSSYLY WYQQKSGSSPKLWIY

3G9LV 1 (D EIVLTQSPATLSLSPGERATLSC SASSSVSSSYLY WYQQKPGQAPRLWIY

3G9LV2 (D EIVLTQSPATLSLSPGERATLSC SASSSVSSSYLY WYQQKPGQAPRLWIY

3G9LV3 (D EIVLTQSPATLSLSPGERATLSC SASSSVSSSYLY WYQQKPGQAPRLWIY

3G9LV4 (D QIVLTQSPATLSLSPGERATLSC SASSSVSSSYLY WYQQKPGQAPRLWIY

3G9LV5 (D EIVLTQSPATLSLSPGERATLSC SASSSVSSSYLY WYQQKPGQAPRLLIY

L6 (D EIVLTQSPATLSLSPGERATLSC - -6 — - - -WYQQKPGQAPRLLIY

CDR2 FR3 CDR3
Murino (51) STSNLAS GVPVRFSGSGSGTSFSLTISSMEAEDAASYFC HQWSTYPPT

3G9LV 1 (51) STSNLAS GVPVRFSGSGSGTDFTLTISSLEPHDFAVYFC HQWSTYPPT

3G9LV2 (51) STSNLAS GVPARFSGSGSGTDFTLTISSLEPEDFAVYYC HQWSTYPPT

3G9LV3 (51 ) STSNLAS GIPARFSGSGSGTDFTLT1SSLEPEDFAVYYC HQWSTYPPT 3G9LV4 (51) STSNLAS GIPARFSGSGSGTDFTLTISSLEPEDFAVYYC HQWSTYPPT 3G9LV5 (51) STSNLAS GIPARFSGSGSGTDFTLTISSLEPEDFAVYYC HQWSTYPPT L6 (50) GIPARFSGSGSGTDFTLTISSLEPEDFAVYYC
As versões 1 e 2 da cadeia pesada de huEG9 e as versões 1 , 2, e 3 da cadeia leve foram feitas sinteticamente por ligação de uma composição de oligonucleotídeos do filamento superior fosforilados, mantidos em justaposição por oligonucleotídeos de filamento inferior, com Taq DNA ligase (New England Biolabs). As reações foram incubadas através de 15 ciclos de 1 minuto a 94°C, 1 minuto a 55°C -1 °C por ciclo e 65°C por 4 minutos gerando um molde de DNA de filamento simples incluindo os sítios de restrição 5' (Notl e BamHI), sequências de sinais, as regiões variáveis; e se estendendo até (cadeia leve) ou nos domínios constantes (cadeia pesada) para o primeiro sítio de restrição único, potencial (BsiWI para a cadeia leve de Agel para a cadeia pesada). Os iniciadores para os genes sintéticos são descritos abaixo. Os moldes de gene foram amplificados por PCR com Pfu DNA poli-merase (Stratagene) usando oligos:
5' GCTGACAGCGGCCGCGGGATCCAC 3' (SEQ ID NO: 18), e
5' GCTCACGGTCACCGGTTCGGGG 3' (SEQ ID NO: 19) para a cadeia pesada e

5' GCTGACAGCGGCCGCGGGATCCAC 3' (SEQ ID NO: 20) e
5' GGAAGATGAACACACTGGGTGCGG 3 ' (SEQ ID NO: 21 ) para a cadeia leve para gerar DNA de filamento duplo. As reações consistiram em uma fusão inicial de 95°C, por 2,5 minutos, seguidas por 16 ciclos de fusão a 94°C, por

30 segundos, anelando a 64°C, por 30 segundos, e elongação a 72°C, por 1 minuto. Os produtos de reação foram purificados com gel usando o kit de extração com gel Qiagen Quiaquick, seguindo o protocolo recomendado pelo fabricante.
A versão 1 da cadeia pesada foi criada sinteticamente a partir dos seguintes oligonucleotídeos fosforilados 5' de filamento superior:
5'GCTGACAGCGGCCGCGGGATCCACCATGGACTTCGGCCTGAGCTGGGTGTTCCT GGTGCTGGTGCTGAAGGGCGTGCAGTGCGAGGTGATGCTGGTGGAGAGCGGCGG
C 3' (SEQ ID NO: 22),
5'GGCCTGGTGCAGCCCGGCGGCAGCCTGAGGCTGAGCTGCGCCGCCAGCGGCTT CACCTTCAGCCGCTACGTGATGAGCTGGGTGCGCCAGGCCCCCGGCAAGGGCCTG GAGTGGGTGGCCAG 3' (SEQ ID NO: 23),
5'CATCAGCAGCGGAGGCCGCATGTACTACCCCGACACCGTGAAGGGCCGCTTCA CCATCAGCCGCGACAGCGCCAAGAACAGCCTGTACCTGCAGATGAACAGCCTGC GCGCCGAGGAC 3' (SEQ ID NO: 24),
5'ACCGCCGTGTACTACTGCGCCCGCGGCAGCATCTACGACGGCTACTACGTGTTC CCCTACTGGGGCCAGGGCACCCTGGTGACCGTGAGCTCCGCCAGCACC 3' (SEQ ID NO: 25),
5'AAGGGCCCCAGCGTGTTCCCCCTGGCCCCCAGCAGCAAGAGCACCAGCGGCGG CACCGCCGCCCTGGGCTGCCTGGTGAAGGACTACTTCeCCGAACCGGTGACCGTG AGC 3' (SEQ ID NO: 26).
Esses oligos foram mantidos em justaposição pelos seguintes oligonucleotídeos não fosforilados do filamento inferior que se sobrepõem aos oligonucleotídeos do filamento superior justapostos por cerca de 15 bp. Os oligonucleotídeos do filamento inferior são:
5'GCTGCACCAGGCCGCCGCCGCTCTCC 3" (SEQ ID NO: 27),
5' CCGCTGCTGATGCTGGCCACCCAC 3" (SEQ ID NO: 28),
5' GCAGTAGTACACGGCGGTGTCCTCGGCGCG 3" (SEQ ID NO: 29),
5' G CTG G G G CCCTTG GTGCTG G CGG 3" (SEQ ID NO: 30).
A Versão 2 da cadeia pesada foi criada sinteticamente a partir dos seguintes oligonucleotídeos fosoforilados 5' do filamento superior:
51GCTGACAGCGGCCGCGGGATCCACCATGGACTTCGGCCTGAGCTGGGTGTTCCT GGTGCTGGTGCTGAAGGGCGTGCAGTGCGAGGTGCAGCTGGTGGAGAGCGGCGG
C 3" (SEQ ID NO: 31)
5'GGCCTGGTGCAGCCCGGCGGCAGCCTGAGGCTGAGCTGCGCCGCCAGCGGCTT CACCTTCAGCCGCTACGTGATGAGCTGGGTGCGCCAGGCCCCCGGCAAGGGCCTG GAGTGGGTGGCCAG 3' (SEQ ID NO: 32),
5'CATCAGCAGCGGAGGCCGCATGTACTACCCCGACACCGTGAAGGGCCGCTTCA CCATCAGCCGCGACAGCGCCAAGAACAGCCTGTACCTGCAGATGAACAGCCTGC GCGCCGAGGAC 3' (SEQ ID NO: 33),
5'ACCGCCGTGTACTACTGCGCCCGCGGCAGCATCTACGACGGCTACTACGTGTTC CCCTACTGGGGCCAGGGCACCCTGGTGACCGTGAGCTCCGCCAGCACC 3' (SEQ ID NO: 34), 5'AAGGGCCCCAGCGTGTTCCCCCTGGCCCCCAGCAGCAAGAGCACCAGCGGCGG CACCGCCGCCCTGGGCTGCCTGGTGAAGGACTACTTCCCCGAACCGGTGACCGTG AGC 3' (SEQ ID NO: 35).
Esses oligos foram mantidos em justaposição pelos seguintes oligonucleotídeos não fosforilados do filamento inferior que se sobrepõem aos oligonucleotídeos do filamento superior justapostos por cerca dd 15 bp. Os oligonucleotídeos do filamento inferior são:
5' GCTGCACCAGGCCGCCGCCGCTCTCC 3" (SEQ ID NO: 36),
5' CCGCTGCTGATGCTGGCCACCCAC 3" (SEQ ID NO: 37),
5'GCAGTAGTACACGGCGGTGTCCTCGGCGCG 3" (SEQ ID NO: 38),
5' GCTGGGGCCCTTGGTGCTGGCGG 3" (SEQ ID NO: 39)
Vetores de expressão para as versões 1 e 2 das cadeias pesadas de hu3G9 foram feitos por subclonagem dos fragmentos de domínios variáveis da cadeia pesada NotI-Agel de 538 bp, incluindo os primeiros 105 bp da região constante de lgG1 humano, as partir das variantes de humanização geradas sinteticamente e o fragmentos Agel/BamHI de 919 bp do plasmídio pKJS160, contendo o restante da região constante de lgG1 humano, em pKJS160 digerido com Notl/BamHI (idêntico ao vetor de expressão pCH269 de EBC derivado de pCEP4 (Invitrogen) produzindo os vetores de expressão da cadeia pesada pKJS166 (versão 1 ) e pKJS167 (versão 2).
A versão 3 da cadeia pesada foi criada realizando-se um único -ciclo de mutagênese direcionada a sítios Quickchange no plasmídio pKJS167 com oligonucleotídeos:
5'CCATCAGCCGCGACAACGCCAAGAACAGCCTG 3' (SEQ ID NO: 40), e
5' CAGGCTGTTCTTGGCGTTGTCGCGGCTGATGG 3' (SEQ ID NO: 41 ).
O plasmídio de cadeia pesada de versão 3 resultante foi designado como pKJS168. As sequências de cDNA da região variável nos plas-mídios resultantes foram confirmadas por sequenciamento de DNA.
A Versão 1 da cadeia leve foi criada sinteticamente a partir dos seguintes oligonucleotídeos fosforilados 5' do filamento superior:
5'GCTGACAGCGGCCGCGGGATCCACCATGGACTTCCAGGTGCAGATCTTCAGCTT CCTGCTGATCAGCGTGAGCGTGATCATGAGCCGCGGCGAGATCGTGCTGACC 3 1 (SEQ ID NO: 42),
5'CAGAGCCCCGCCACCCTGAGCCTGAGCCCCGGCGAGAGGGCCACCCTGAGCTG CAGCGCÇAGCAGCAGCGTGAGCAGCAGCTACCTGTACTGGTACCAGCAGAAGCC CGGCCAGGCC 3' (SEQ ID NO: 43),
5'CCCAGGCTGTGGATCTACAGCACCAGCAACCTGGCCAGCGGCGTGCCCGTGCGC TTCAGCGGCAGCGGCAGCGGCACCGACTTCACCCTGACCATCAGCAGCCTGGAGC CCGAGGAC 3' (SEQ ID NO: 44),
5'TTCGCCGTGTACTTCTGCCACCAGTGGAGCACCTACCCCCCCACCTTCGGCGGC GGCACCAAGGTGGAGATCAAGCGTACGGTGGCCGCACCCAGTGTGTTCATCTTCC 3' (SEQ ID NO: 45).
Esses oligos foram mantidos em justaposição pelos seguintes oligonucleotídeos não fosforilados do filamento inferior que se sobrepõem aos oligonucleotídeos do filamento superior justapostos por cerca de 15 bp. Os oligonucleotídeos do filamento inferior são:
5'GCGGGGCTCTGGGTCAGCACGATC 3" (SEQ ID NO: 46),
5'CCACAGCCTGGGGGCCTGGCCG 3" (SEQ ID NO: 47),
5'GTACACGGCGAAGTCCTCGGGCTC 3" (SEQ ID NO: 48).
A versão 2 da cadeia leve foi criada sinteticamente a partir dos seguintes oligonucleotídeos fosforilados 5' do filamento superior:
5'GCTGACAGCGGCCGCGGGATCCACCATGGACTTCCAGGTGCAGATCTTCAGCTT CCTGCTGATCAGCGTGAGCGTGATCATGAGCCGCGGCGAGATCGTGCTGACC 3 ' (SEQ ID NO: 49),
5'CAGAGCCCCGCCACCCTGAGCCTGAGCCCCGGCGAGAGGGCCACCCTGAGCTG CAGCGCCAGCAGCAGCGTGAGCAGCAGCTACCTGTACTGGTACCAGCAGAAGCC CGGCCAGGCC 3' (SEQ ID NO: 50),
5'CCCAGGCTGTGGATCTACAGCACCAGCAACCTGGCCAGCGGCGTGCCCGCCCGC TTCAGCGGCAGCGGCAGCGGCACCGACTTCACCCTGACCATCAGCAGCCTGGAGC CCGAGGAC 3' (SEQ ID NO: 51),
5'TTCGCCGTGTACTACTGCCACCAGTGGAGCACCTACCCCCCCACCTTCGGCGGC GGCACCAAGGTGGAGATCAAGCGTACGGTGGCCGCACCCAGTGTGTTCATCTTCC
3' (SEQ ID NO: 52).
Esses oligos foram mantidos em justaposição pelos seguintes oligonucleotídeos não fosforilados do filamento inferior que se sobrepõem aos oligonucleotídeos justapostos do filamento superior por cerca de 15 bp. Os oligonucleotídeos do filamento inferior são:
5'GCGGGGCTCTGGGTCAGCACGATC 3" (SEQ ID NO: 53),
5'CCACAGCCTGGGGGCCTGGCCG 3" (SEQ ID NO: 54),
5' GTACACGGCGAAGTCCTCGGGCTC 3" (SEQ ID NO: 55).
A versão 3 da cadeia leve foi criada sinteticamente a partir dos seguintes oligonucleotídeos fosforilados 5' do filamento superior:
5'GCTGACAGCGGCCGCGGGATCCACCATGGACTTCCAGGTGCAGATCTTCAGCTT CCTGCTGATCAGCGTGAGCGTGATCATGAGCCGCGGCGAGATCGTGCTGACC 3 ' (SEQ ID NO: 56),
5'CAGAGCCCCGCCACCCTGAGCCTGAGCCCCGGCGAGAGGGCCACCCTGAGCTG CAGCGCCAGCAGCAGCGTGAGCAGCAGCTACCTGTACTGGTACCAGCAGAAGCC CGGCCAGGCC 3' (SEQ ID NO: 57),
5'CCCAGGCTGTGGATCTACAGCACCAGCAACCTGGCCAGCGGCATCCCCGCCCGC TTCAGCGGCAGCGGCAGCGGCACCGACTTCACCCTGACCATCAGCAGCCTGGAGC CCGAGGAC 3' (SEQ ID NO: 58),
5'TTCGCCGTGTACTACTGCCACCAGTGGAGCACCTACCCCCCCACCTTCGGCGGC GGCACCAAGGTGGAGATCAAGCGTACGGTGGCCGCACCCAGTGTGTTCATCTTCC
3' (SEQ ID NO: 59).
Esses oligos foram mantidos em justaposição pelos seguintes oligonucleotídeos não fosforilados do filamento inferior que se sobrepõem aos oligonucleotídeos do filamento superior justapostos por cerca de 15 bp. Os oligonucleotídeos do filamento inferior são:
5' GCGGGGCTCTGGGTCAGCACGATC 3" (SEQ ID NO: 60),
5' CCACAGCCTGGGGGCCTGGCCG 3" (SEQ ID NO: 61),
5' GTACACGGCGAAGTCCTCGGGCTC 3" (SEQ ID NO: 62).
Vetores de expressão para as versões 1 , 2 e 3 das cadeias leves de hU3G9 foram feitos por subclonagem dos fragmentos de domínios variáveis de cadeia leve NotI/BsiWI a partir das variantes de humanização geradas sinteticamente e o fragmento BsiWI/BamHi de 324 bp a partir de pKJS162, contendo a região constante kappa de imunoglobulina humana, no pKJS161 digerido com Notl/BamHI (também idêntico ao vetor de expressão pCH269 de EBV derivado de pCEP4 (Invitrogen)). Os plasmídios resultantes foram designados como pKJS172 (versão 1), pKJS173 (versão 2), e pKJS174 (versão 3).
Exemplo 4: Expressão das Versões 1 , 2 & 3 de hu3G9 e Construções das Versões 4 e 5
Todas as possíveis combinações de vetores de expressão quiméricos de cadeias pesadas e leves foram co-transfectadas em células 293-EBNA (16 combinações). As células transfectadas foram testadas para se-creçãq de anticorpo e especificidade. Análise de Western blot (detecção com anticorpos antihumanos de cadeias pesadas e leves) e análise Easy Titer (Pierce) de meio condicionado indicaram que as células transfectadas com hu3G9 sintetizaram e secretaram eficazmente as cadeias pesadas e leves e que os níveis de expressão pareceram aumentar com a humanização cres-cente dos anticorpos. Como mostrado na figura 2, as variantes contendo a versão 1 da cadeia leve expressaram fracamente, enquanto as variantes contendo a versão 2 da cadeia leve são expressas em níveis maiores, sugerindo que a humanização crescente tende à maior expressão.
Análise FACS de células SW480 expressando ανββ coloridas com meio condicionado de células transfectadas indicaram que a humanização da cadeia pesada xle 3G9 não teve impacto negativo sobre a capacidade do anticorpo de se ligar às células que expressam ονββ, com a versão 3 da cadeia pesada (versão enxertada com CDR) tendo atividade de ligação crescente em comparação com as versões 1 e 2 (figura 3). Análise FACS também demonstrou que variantes de hu3G9 mAb contendo a versão 3 da cadeia leve se ligou ligeiramente menos que as variantes contendo a versão 2 de cadeia leve de hu3G9, embora ambas as versões pareceram se ligar pelo menos tão bem quanto 3G9 quimérico (figura 3). Existem somente diferenças de 2 e 1 aminoácido entre as cadeias leves da versão 2 e 3, respecti-vãmente, e 3G9 enxertado com CDR. Já que essas versões da cadeia leve tinham atividade de ligação similar a νβ6 como 3G9 quimérico, duas versões adicionais foram criadas para determinar se a atividade de ligação po- deria ser aperfeiçoada ou se a versão enxertada com CDR seria funcional.
A versão 4 explorou os efeitos da substituição da glutamina para ácido glutâmico na posição 1 da cadeia leve e a versão 5 é uma cadeia leve de 3G9 enxertada com CDR (Tabela 1). Para examinar as contribuições individuais de cada dessas alterações, foram construídos novos vetores de expressão de cadeia leve. O plasmídio pKJS186, a variante E1Q da cadeia leve da versão 3, foi feito por mutagênese direcionada a sítios do plasmídio pKJS174 com os oligonucleotídeos:
5'GTCAGCACGATCTGGCÇGCGGCTCATGATC 3' (SEQ ID NO: 63) e
5' GATCATGAGCCGCGGCCAGATCGTGCTGAC 3' (SEQ ID NO: 64)
usando kit de mutagênese Quickchange da Stratagene e é designado como versão 4 de cadeia leve. O plasmídio pKJS188, a cadeia leve de 3G9 enxertada com CDR, foi feito por mutagênese direcionada a sítios de plasmídio pKJS174 como oligonucleotídeos:
5'CCCAGGCTGCTGATCTACAGCACC 3' (SEQ ID NO: 65) e
5'GGTGCTGTAGATCAGCAGCCTGGG 3' (SEQ ID NO: 66)
e é designado como versão 5 de cadeia leve. Essas versões da cadeia leve foram confirmadas por sequenciamento e então co-transfectadas em células 293-EBNA com versões 2 ou 3 de cadeia pesada. Análise FACS indicou que a versão 3 de cadeia pesada e a versão 5 de cadeia leve, o par completamente enxertado com CDR, ligaram às células de expressão de ανββ de modo igual ou melhor que qualquer outro par de variantes humanizado (figura 4). O pareamento de pKJS 68 e pKJS188 foi designado como versão 5 de hu3G9 (H3/L5).
Co-transfecções de células 293-EBNA com as versões 2-5 de ch3G9 e hu3G9 foram raspadas e o meio condicionado foi colhido. O anticorpo foi purificado em Proteína A-Sepharose e mAbs purificados foram ensaiados quanto à atividade. A ligação a θνββ foi determinada por análise FACS na linhagem celular FDCPI -ββ (figura 5), ELISA (figura 6), e bloqueio de θνβ6 biotinilado a LAP (figura 7). A ordem de classificação da atividade de ligação era versão 5 (H3/L5) > versão 3 (H3/L3) = ch3G9 = versão 2 (H2/L2). Bloqueio de adesão das células FDCPI -ββ mediada por ανβε a LAP é mos- trado na figura 8. A ordem de classificação de bioatividade era çh3G9 = versão 5 (H3/L5) = versão 2 (H2/L2)> versão 3 (H3/L3). Devido ao fato da versão 5 ser mais humanizada que a versão 2, ela foi selecionada para a geração de uma linhagem de célula CHO estável.
O DNA e as sequências de proteínas correspondentes das versões diferentes de domínios variáveis pesados (versões 1 , 2, 3, e 5) e leves de hu3G9 (versões 1 -5) são mostrados na Tabela 2.
(á) uma FR humana derivada da FRI de VH3-7;
(b) sequências de cadeias pesadas de CDR1 de 3G9 murino;
(c) uma FR2 humana derivada da FR2 de VH3-7;
(d) sequências de cadeias pesadas de CDR2 de 3G9 murino;
(e) uma FR humana derivada da FR3 de VH3-7;
(f) uma FR3 humana derivada da FR3 de VH3-7;
(g) sequências de cadeias pesadas de CDR3 de 3G9; e
(h) uma FR4 humana derivada de uma sequência de estruturas de consenso presente em uma grande maioria de anticorpos humanos com a seguinte sequência:
WG QGTLVTVSS .
Para os domínios variáveis de cadeia leve, as sequências compreendem:
(a) uma FR1 humana derivada da FR1 de L6;
(b) a sequência de cadeias leves de CDR1 de 3G9 murino com uma substituição de aminoácido de asparagina (N) para serina (S);
(c) uma FR2 humana derivada da FR2 de L6;
(d) a sequência de cadeias leves de CDR2 de 3G9 murino;
(e) uma FR humana derivada da FR3 de L6;
(f) a sequência de cadeia leves de CDR3 de 3G9 murino; e
(g) uma FR4 humana derivada de uma sequência de estruturas de consenso presente em uma grande maioria de anticorpos humanos com a seguinte sequência:
FGGGTKVEIK.

TABELA 2 - SegCiências de Cadeias Pesadas e Leves de Domínios Variáveis de hu3G9
cadeia leve da versão 1 de hu3G9 (SEQ ID NO:67)
1 GAGATCGTGCTGACCCAGÁGCCCCGCCACCCTGAGCCTGAGCCCCGGCGAGAGGGCCACC

E I V L T Q S P A T L S L S P G E R A T
61 CTGAGCTGCAGCGCCAGCAGCAGCGTGAGCAGCAGCTACCTGTACTGGTACCAGCAGAAG
L S C S A S S S V S S S Y L Y W Y Q Q K
121 CCCGGCCAGGCCCCCAGGCTGTGGATCTACAGCACCAGCAACCTGGCCAGCGGCGTGCCC
P G Q A P R L W 1 Y S T S N L A S G V P 181 GTGCGCTTCAGCGGCAGCGGCAGCGGGACCGACTTCACCCTGACCATCAGCAGCCTGGAG

V R F S G S G S G T D F T L T I S S L E
241 CCCGAGGACTTCGCCGTGTAC TCTGCCACCAGTGGAGCACCTACCCCCCCACCTTCGGC

P E D F A V Y F C H Q W S T Y P P T F G
301 GGCGGCACCAAGGTGGAGATCAAG
G G T K V E I K
cadeia leve da versão 2 de hu3G9 (SEQ ID NO:68)
1 GAGATCGTGCTGACCCAGAGCCCCGCCACCCTGAGCCTGAGCCCCGGCGAGAGGGCCACC
E I V L T Q S P A T L S L S P G E R A T
61 CTGAGCTGCAGCGCCAGCAGÇAGCGTGAGCAGCAGCTACCTGTACTGGTACCAGCAG AAG
L S C S A S S S V S S S Y L Y W Y Q Q
121 CCCGGCC AGGCCCCCAGGCTGTGGATCTACAGCACCAGCAACCTGGCC AGCGGCGTGCCC
P G Q A P R L W I Y S T S N L A S G V P
181 GCCCGCTTC AGCGGCAGCGGCAGCGGCACCG ACTTCACCCTGACCATC AGCAGCCTGGAG
A R F S G S G S G T D F T L T I S S L E
241 CCCG AGG ACTTCGCCGTGTACTACTGCCACCAGTGG AGCACCTACCCCCCCACCTTCGGC
P E D F A V Y Y C H Q W S T Y P P T F G
301 GGCGGCACCAAGGTGGAGATCAAG
G G T K V E I K
cadeia leve da versão 3 de hu3G9 (SEQ ID NO:69)
1
GAGATCGTGCTGACCCAGAGCCCCGCCACCCTGAGCCTGAGCCCCGGCGAGAGGGCCACC

E I V L T Q S P A T L S L S P G E R A T CTGAGCTGCAGCGCCAGCAGCAGCGTGAGCAGCAGCTACCTGTACTGGTACCAGCAGAAG
L S C S A S S S V S S S Y L Y W Y Q Q K

121
CCCGGCCAGGCCCCCAGGCTGTGGATCTACAGCACCAGCAACCTGGCCAGCGGCATCCCC

P G Q A P R L W I Y S T S N L A S G 1 P

181
GCCCGCTTCAGCGGCAGCGGCAGCGGCACCGACTTCACCCTGACCATCAGCAGCCTGGAG

A R F S G S G S G T D F T L T 1 S S L E 241
CCCGAGGACTTCGCCGTGTACTACTGCCACCAGTGGAGCACCTACCCCCCCACCTTCGGC

P E D F A V Y Y C H Q W S T Y P P T F G

301 GGCGGCACCA AGGTGG AG ATCAÀG
G G T K V E l K
cadeia leve da versão 4 de hu3G9 (SEQ IP NQ:70)
1
CAGATCGTGCTGACCCAGAGCCCCGCCACCCTGAGCCTGAGCCCCGGCGAGAGGGCCACC

Q I V L T Q S P A T L S L S P G E R A T

61
CTGAGCTGCAGCGCCAGCAGCAGCGTGAGCAGCAGCTACCTGTACTGGTACCAGCAGAAG

L S C S A S S S -V S S S Y L Y W Y Q Q

121
CCCGGCCAGGCCCCCAGGCTGTGGATCTACAGCACCAGCAACCTGGCCAGCGGCATCCCC

P G Q A P R L W I Y S T S N L A S G 1 P 181
GCCCGCTTCAGCGGCAGCGGCAGCGGCACCGACTTCACCCTGACCATCAGCAGCCTGGAG

A R F S G S G S G T D F T L T I S S L E

241
CCCGAGGACTTCGCCGTGTACTACTGCCACCAGTGGAGCACCTACCCCCCCACCTTCGGC P E D F A V Y Y C H Q W S T Y P P T F G
301 GGCGGCACCAAGGTGGAGATCAAG
G G T K V E l K cadeia leve da versão 5 de hu3G9 (SEQ IP NO:71)
1 AGATCGTGCTGACCCAGAGCCCCGCCACCCTGAGCCTGAGCCCCGGCGAGAGGGCCACC E I V L T Q S P A T L S L S P G E R A T 61 TG AGCTGC AGCGCC AGC AGCAGCGTG AGC AGC AGCTACCTGTACTGGTACCAGC AG AAG

L S C S A S S S V S S S Y L Y W Y Q Q K 121 CCGGCC AGGCCCCCAGGCTGCTGATCTAC AGC ACC AGC AACCTGGCCAGCGGCATCCCC

P G Q A P R L L 1 Y S T S N L A S G I P 181 CCCGCTTCAGCGGCAGCGGCAGCGGCACCGACTTCACCCTGACCATCAGCAGCCTGGAG

A R F S G S G S G T D F T L T 1 S S L E 241 CCGAGGACTTCGCCGTGTACTACTGCCACCAGTGGAGCACCTACCCCCCCACCTTCGGC
P E D F A V Y Y C H Q W S T Y P P T F G
301 GGCGGCACCAAGGTGGAGATCAAG
G G T K V E 1
cadeia pesada da versão 1 de hu3G9 (SEQ ID NO:72)
1 AGGTGATGCTGGTGGAGAGCGGCGGCGGCCTGGTGCAGCCCGGCGGCAGCCTGAGGCTG

E V M L V E S G G G L V Q P G G S L R L 61 GCTGCGCCGCC AGCGGCTTC ACCTTC AGCCGCTACGTG ATG AGCTGGGTGCGCC AGGCC
S C A A S G F T F S R Y V M S W V R Q A
121 CCGGCA AGGGCCTGG AGTGGGTGGCCAGCATCAGCAGCGGAGGCCGCATGTACTACCCC

P G K G L E W V A S I S S G G R M Y Y P 181 AC ACCGTG A AGGGCCGCTTCACC ATCAGCCGCGAC AGCGCCAAGAACAGCCTGTACCTG
D T V K G R F T I S R D S A K N S L Y L 241 AGATGAACAGCCTGCGCGCCGAGGACACCGCCGTGTACTACTGCGCCCGCGGCAGCATC
Q M N S L R A E D T A V Y Y C A R G S I 301 ACGACGGCTACTACGTGTTCCCCTACTGGGGCCAGGGCACCCTGGTGACCGTGAGCTCC
Y D G Y Y V F P Y W G Q G T L V T V S S
cadeia pesada da versão 2 de hu3G9 (SEQ ID NO:73)
1 AGGTGCAGCTGGTGGAGAGCGGCGGCGGCCTGGTGCAGCCCGGCGGCAGCCTGAGGCTG E V Q L V E S G G G L V Q P G G S L R L

61 GCTGCGCCGCC AGCGGCTTC ACCTTC AGCCGCTACGTG ATG AGCTGGGTGCGCC AGGCC
S C A A S G F T F S R Y V M S W V R Q A
121 CCGGCA AGGGCCTGGAGTGGGTGGCCAGCATCAGCAGCGG AGGCCGCATGTACTACCCC P G K G L E W V A S I S S G G R M Y Y P 181 ACACCGTG A AGGGCCGCTTC ACC ATCAGCCGCG ACAGCGCCA AG A AC AGCCTGTACCTG
D T V K G R F T I S R D S A K N S L Y L
241 AGATG AACAGCCTGCGCGCCG AGG ACACCGCCGTGTACTACTGCGCCCGCGGC AGCATC
Q N S L R A E D T A V Y Y C A R G S I
301 ACGACGGCTACTACGTGTTCCCCTACTGGGGCCAGGGCACCCTGGTGACCGTGAGCTCC
Y D G Y Y V F P Y W G Q G T L V T V S S
cadeia pesada das versões 3 e 5 de hu3G9 (SEQ ID NO:74)
1 AGGTGCAGCTGGTGGAGAGCGGCGGCGGCCTGGTGCAGCCCGGCGGCAGCCTGAGGCTG
E V Q L V E S G G G L V Q P G G S L R L
61 GCTGCGCCGCC AGCGGCTTC ACCTTC AGCCGCTACGTGATGAGCTGGGTGCGCC AGGCC
S C A A S G F T F S R Y V M S W V R Q A
121 CCGGCA AGGGCCTGG AGTGGGTGGCCAGC ATCAGC AGCGGAGGCCGC ATGTACTACCCC
P G K G L E W V A S I S S G G R M Y Y P
181 ACACCGTG AAGGGCCGCTTC ACC ATCAGCCGCG ACAACGCCAAGAACAGCCTGTACCTG
D T V K G R F T I S R D N A K N S L Y L
241 AGATGAACAGCCTGCGCGCCGAGGACACCGCCGTGTACTACTGCGCCCGCGGCAGCATC
Q M N S L R A E D T A V Y Y C A R G S 1 301 ACGACGGCTACTACGTGTTCCCCTACTGGGGCCAGGGCACCCTGGTGACCGTGAGCTCC
Y D G Y Y V F P Y W G Q G T L V T V S S
Exemplo 5: Construção de Vetores de Expressão de CHO Estáveis para Versão 5 do hu3G9 tipo selvagem e aqlicosila
Os vetores EBV descritos acima contêm UTRS 5' e 3' estranhas que são indesejáveis. Vetores de expressão de CHO estáveis foram criadas para versão 3 de cadeia pesada de hu3G9 e versão 5 de cadeia leve (H3/L5), coletivamente denominadas versão 5, em que as sequências estranhas foram removidas. Adicionalmente, um vetor de cadeia pesada aglicosi-la foi criado para remover interações potenciais entre o anticorpo 3G9 expresso e receptores de Fc gama.
O vetor de expressão de CHO estável da cadeia pesadas foi criado por ligação do fragmento BamHi de 723 pares de base de pKJS188 ao fragmento de vetor digerido com BamHi neo-contendo 6188 pares de base de pKJS077 (PDM-64-0213) gerando o plasmídio pKJS195, conforme mostrado na figura 9.
O vetor de expressão CHO estável da cadeia pesada foi criado ligando inicialmente o fragmento BamHI de 1449 pares de base a partir do pKJS168 no fragmento de vetor digerido com BamHI de 6051 pares de base de pKJS078 (PDM-64-02-13) para remover os sítios de restrição Notl que flanqueiam a sequência de codificação de cadeia pesada e gerando pKJS171. Para remover geneticamente o resíduo de lisina C-terminal da cadeia pesada codificada por pKJS171 , o fragmento BsrG1 de 2190 pares de base para Xba1 de pKJS171 foi reposto com o fragmento BsrG1 de 2187 pares de base para Xba1 de pKJS078 (PDM-64-02-13) gerando pKJS189. O plasmídio pKJS189 representa o vetor de expressão CHO estável de hu-3G9 do tipo selvagem contendo dhf r, conforme mostrado na figura 10. Para gerar a forma aglicosila da cadeia pesada, o fragmento Agel/BsrG1 de 587 pares de base de pKJS189 foi reposto com o fragmento Age1/BsrG1 de 587 pares de base de pGR076 gerando pKJS196. Esse vetor representa o vetor de expressão CHO estável de aglicosila-hu3G9 contendo dhfr, contendo uma substiuição de N319Q que remove o sinal de glicosilação requerido para ligação de receptor de Fc normal, conforme mostrado na figura 11.
As sequências de DNA das inserções de cDNA de BamHI nos pKJS189, pKJS196, e pKJS195 foram confirmadas. Os vetores de expressão foram co-transfectados em células CHO e as células transfectadas foram testadas quanto à secreção de anticorpos. O ensaio de detecção de anticorpo humano Easy-Titer (Pierce) do meio condicionado indicou que as células transfectadas sintetizaram e secretaram, eficazmente, as cadeias pesadas e leves dos vetores de expressão CHO, conforme mostrado na figura 12.
Assim, existem dois potenciais sítios de glicosilação que podem ser modificados no anticorpo hu-3G9 sem afetar a afinidade de ligação do anticorpo: (1 ) nos domínios variáveis da cadeia leve de hu-3G9 dentro da região de CDR1 no resíduo de aminoácido 26 da SEQ ID NO:2, onde uma substituição de asparagina (N) para serina (S) remove o sítio de glicosilação que aperfeiçoa a expressão e purificação (este sítio é modificado em todas as cinco versões das sequências de domínios variáveis de cadeia pesada); e (2) na região constante da versão 3 de cadeia pesada de hu-3G9, em que uma substituição de asparagina (N) para glutamina (Q) remover um sítio de glicosilação para ligação de receptor de Fc.
Exemplo 6: Linhagens de Células CHO Expressando a Versão 5 de hu3G9
Os plasmídios de expressão pKJS189, pKJS196 e pKJS195 para a versão 5 de 3G9 foram transfectadas em células CHO. A expressão da versão 5 de hu3G9 (H3/L5) e a versão 5 de hu3G9 aglicosilada (a-H3/L5) mostrou especificidade de ligação para Ονββ.
Exemplo 7: Desenho da Humanização do Anticorpo 8G6 Αηΐί-ο ββ
No desenho dos anticorpos humanizados, as regiões determinantes de complementaridade (CDRs) contêm os resíduos mais prováveis de se ligarem a antígeno e devem ser retidas no anticorpo remodelado. C-DRs são definidas pela sequência de acordo com Kabat et al., Sequences of Proteins of Immunological Interest, 5ã Edição, U.S. Dept. Health and Human Services, U.S. Govt. Priniting Office (1991 ). As CDRs se enquadram nas classes canónicas (Chothia et al., Nature, 342:877-883 (1989)) onde os resíduos chave determinam, em uma grande extensão, a conformação estrutural da alça de CDR. Esses resíduos ficam quase sempre retidos no anticorpo remodelado. As CDRs da cadeia pesada e leve foram classificadas em classes canónicas como a seguir:

Cadeia Leve: Cadeia Pesada:
L1 : 15 resíduos Classe 4 H1 : 5 resíduos Classe 1
L2: 7 resíduos Classe 1 H2: 17 resíduos Classe 2
L3: 9 resíduos Classe 1 H3: 17 resíduos Sem classe canónica
Os resíduos canónicos importantes para essas classes estão indicados na Tabela 3. Todos os resíduos canónicos são como descritos pelas regras. Não existem classes canónicas para a alça H3.
Tabela 3
L1 Classe 4 2(l) 25(A) 29(V) 33(M) 71 (F)
L2 Classe 1 48(l) 51 (A) 52(S) 64(G)
L3 Classe 1 90(H) 95(P) H1 Classe 1 24(G) 26(S) 27(Y) 29(F) 34(M) 94(R)
H2 Classe 2 523(T) 55(G) 71 (V)
H3 Sem Classificação Canónica
As cadeias leves e pesadas foram comparadas com as sequências de consenso para subgrupos de camundongos e seres humanos (Kabat et al., 1991) usando o programa FASTA.
A cadeia leve variável de 8G6 é um membro do subgrupo Kappa 3 de camundongo com uma identidade de 81 ,250% em sobreposição com 1 12 aminoácidos e a cadeia peasada variável de 8G6 é um membro do subgrupo 2a de camundongos com uma identidade de 71 ,318% em uma sobreposição com 129 aa. A cadeia leve variável de 8G6 corresponde ao subgrupo Kappa 4 humano com 65,487% de identidade com uma sobreposição de 1 13 aa. A cadeia pesada variável de 8G6 corresponde ao subgrupo 1 humano com 58,955% de identidade com sobreposição de 134 aa. Os resíduos de interface de empacotamento de VH/VL são conservados, exceto para uma F não usual na posição 50 de aminoácido na cadeia leve (da SEQ ID NO:4) e uma L na posição 39 de aminoácido na cadeia pesada (da SEQ ID NO:3).
Modelação da estrutura das regiões variáveis foi realizada como a seguir. As cadeias leves e pesadas foram alinhadas contra uma cópia local da mais recente base de dados PDB para determinar as armações estruturais a serem usadas para construir os modelos tridimensionais das cadeias leves e pesadas. Usando FASTA, verificou-se que a cadeia leve de 8G5 ti-nha 90,001% de identidade de sequência com uma sobreposição de 111 aa para N10 Fab murino (1 NSN; resolução de 2,9 Á). Verificou-se que a cadeia pesada de 8G6 tinha 80,952% de identidade de sequência com uma sobreposição de 126 aminoácidos para Fab de JEL42 murino (2JEL; Resolução de 2,5 Á). O molde estrutural integral foi obtido por combinação da cadeia pesada de 2JEL e da cadeia leve de 1 NSN. Usando um empacotamento de modelação molecular Modeler 5,0 (Accelrys Inc.), as estruturas tridimensionais das cadeias leves e pesadas foram construídas usando a estrutura de molde. O dez moldes de homologia foram criados, e o melhor deles em termos de energia de Modeler foi selecionado. Análise Procheck mostrou que não havia resíduos em uma região desautorizada do mapa phi/psi.
Ao desenhar as regiões variáveis remodeladas, foi feita uma tentativa de encontrar as sequências de anticorpos humanos expressas mais similares para uso como estruturas de anticorpo. Para encontrar as sequências expressas mais próximas, foi realizada uma busca para as estruturas humanas expressas mais homólogas na base de dados NCB1 NR, base de dados TrEMBL e a base de dados Kabat. Para sequências das cadeias leves e pesadas, foram efetuadas duas buscas (com CDR mascarada e não mascarada). A seleção das sequências expressas mais adequadas inclui verificar a identidade das sequências de resíduos canónicos e interfaciais, bem como verificar as similaridades nos comprimentos da alça da CDR. A fonte do anticorpo é também um fator determinante. Anticorpos previamente humanizados são excluídos. Para as buscas nas bases de dados NCB1 NR e TrEMBL, foi usado BLAST, e para a busca na base de dados Kabat, foi usado FASTA.
A cadeia leve expressa mais similar foi encontrada na base de dados Kabat (kabat id 026520 AC21 BOL: Ohlin et al., Mo/. Immunol., 33:47-56 (1996)). Esse é um scFv amplificado por PCR de exibição de fago, mas é 100% idêntico à germe-linha L6 nas regiões de estrutura. Para a cadeia pesada, foi selecionada a estrutura humana gi|392715 da base de dados NR em NGB1 . Ela é 100% idêntica à germe-linha VH1 -2 nas regiões de estrutura. Ambas as sequências foram procuradas contra a base de dados de sequências de germe-linha (http://www.ncbi.nlm.nih.gov/igblst/), e isto resultou nas seguintes germe-linhas selecionadas: L6 para a cadeia leve, e 1 -2 para a cadeia pesada.
O procedimento mais importante na humanização dos anticorpos monoclonais é a identificação de retromutações de resíduos de estrutura humana para camundongo. A experiência mostrou que isto é especialmente importante para reter resíduos canónicos, resíduos de empacotamento de interface, e resíduos murino incomuns, que estão próximos ao sítio de ligação. Em geral, os resíduos localizados dentro de 6 Á de quaisquer do resíduos de CDR não precisam ser analisados intimamente quanto a potenciais efeitos na conformação das CDRs.
Três versões da cadeia remodelada leve variável de 8G6 e as três versões da cadeia remodelada pesada variável de 8G6 foram desenhadas. A primeira versão contém a maioria das retromutaçoes e a terceira versão contém a minoria (isto é as mais "humanizadas"). A Tabela 4 exibe as sequências de domínios variáveis da cadeia pesada e leve para os anticorpos 8G6 (hu8G6).
Tabela 4 - Sequências de Cadeias Pesada e Leve para hu8G6 Tabela 4a - Sequencias da Cadeia Pesada

FRl CDRI FR2
Murino ( ! ) QVQLQQSGPELVRPGVSVK1SCKGSSYTFT DDYYAAMMHH WVKLSHAKSLEWIG

8G6HV 1 ( D QVQLVQSGAEVK PGASVKVSCKGSSYTFT DYAMH WVRLAPGQGLEWIG

8G6HV2 d) QVQLVQSGAEVKKPGASVKVSCKASGYTFT DYAMH WVRQAPGQGLEWIG

8G6HV3 ( D QVQLVQSGAEVK PGASVKVSCKASGYTFT DYAMH WVRQAPGQGLEWMG

VH1-2 ( D QVQLVQSGAEVKKPGASVKVSCKASGYTFT — WVRQAPGQGLEWMG
CDR2 FR3
Murino (50) VISTYYGNTNYNQKFKG KATMTVDKSSSTAYMELARLTSEDSAVYYCAR

8G6HV 1 (50) VISTYYGNTNYNQKFKG RATMTVDKSISTAYMELSRLRSDDTAVYYCAR

8G6HV2 (50) VISTYYGNTNYNQKFKG RATMTVDKSISTAYMELSRLRSDDTAV YYC AR

8G6HV3 (50) VISTYYGNTNYNQKFKG RATMTVDKSISTAYMELSRLRSDDTAVYYCAR

VH1-2 (50) RVTMTRDTSISTAYMELSRLRSDDTAVYYCAR
Tabela 4b - Sequencias da Cadeia Leve
FRl CDRI FR2
Murino ( 1 ) DIVLTQSPASLAVSLGQR AIISC RASQSVSTSSYSYMY WYQQKPGQSPKFLIK

8G6LV 1 (1) DIVLTQSPATLSLSPGERATLSC RASQSVSTSSYSYMY WYQQKPGQAPRFLIK

8G6LV2 (1) EIVLTQSPATLSLSPGERATLSC RASQSVSTSSYSYMY WYQQKPGQAPRFLIK

8G6LV3 (1) EIVLTQSPATLSLSPGERATLSC RASQSVSTSSYSYMY WYQQKPGQAPRLLIK

L6 (1) EIVLTQSPATLSLSPGERATLSC WYQQKPGQAPRLLIY

CDR2 FR 3 CDR3
Murino (54) YASNLES GVPARFSGSGSGTDFTLNIHPVEEEDTATYYC QHNWEIP

8G6LV 1 (54) YASNLES GIPARFSGSGSGTDFTLTISSLEPEDFAVYYC QHNWEIP

8G6LV2 (54) YASNLES GIPARFSGSGSGTDFTLTISSLEPEDFAVYYC QHNWEIP

8G6LV3 (54) YASNLES GIPARFSGSGSGTDFTLTISSLEPEDFAVYYC QHNWEIP

L6 (50) GIPARFSGSGSGTDFTLTISSLEPEDFAVYYC
As sequências de proteínas das diferentes versões dos domínios variáveis pesados (versões 1 , 2 e 3) e leves (versões 1 , 2 e 3) de hu8G6 estão mostrados na Tabela 5. Para os domínios variáveis de cadeia pesada, as sequências compreendem:
(a) uma FR1 derivada da FR1 de VH1 -2;
(b) a sequência da cadeia pesada da CDR1 do 8G6;
(c) uma FR2 humana derivada da FR2 de VH1 -2;
(d) a sequência da cadeia pesada de CDR2 de 8G6;
(e) uma FR3 humana derivada da FR3 de VH 1-2;
(f) a sequência da cadeia pesada da CDR3 de 8G6; e
(g) uma FR4 derivado de uma sequência de estruturas de consenso que é 100 idêntica à estrutura humana gi|392715 da base de dados NR e está presente em uma grande maioria de anticorpos humanos com a seguinte sequência: WGQTLVTVSS.
Para os domínios variáveis de cadeia leve, as sequências compreendem:
(a) uma FR1 humana derivada de L6;
(b) a sequência da cadeia leve da CDR1 de 8G6 murino;
(c) uma FR2 humana derivada da FR2 de L6;
(d) a sequência da cadeia leve da CDR2 de 8G6 murino;
(e) uma FR3 derivada da FR3 da L6;
(f) a sequência da cadeia leve da CDR3 de 8G6 murino; e
(g) uma FR4 humana derivada de uma sequência de estruturas de consenso presente em uma grande maioria de anticorpos humanos com a seguinte sequência: FGGGTKVEIK.
TABELA 5 - Sequências de Cadeias Leves e Pesadas dos Domínios Variáveis de hu8G6
cadeia pesada hu8G6 versão 1 (SEQ ID NO:78)
QVQLVQSGAEVKKPGASVKVSCKGSSYTFTDYAMHWVRLAPGQGLE WIGVISTYYGNTNYNQKFKGRATMTVDKSISTAYMELSRLRSDDTAV YYCARGGLRRGDRPSLQYAMDYWGQGTLVTVSS
cadeia pesada hu8G6 versão 2 (SEQ ID NO:79)
QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYAMHWVRQAPGQGLE WIGVISTYYGNTNYNQKFKGRATMTVDKSISTAYMELSRLRSDDTAV YYCARGGLRRGDRPSLQYAMDYWGQGTLVTVSS
cadeia pesada hu8G6 versão 3 (SEQ ID NO:80)
QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYAMHWVRQAPGQGL EWMGVISTYYGNTNYNQKFKGRATMTVDKSISTAYMELSRLRSDDTA VYYCARGGLRRGDRPSLQYAMDYWGQGTLVTVSS
cadeia leve u8G6 versão 1 (SEQ ID NO:75)
DIVLTQSPATLSLSPGERATLSCRASQSVSTSSYSYMYWYQQKPGQAP RFLnCYASNLESGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQHNWEI PFTFGGGTKVEIK
cadeia leve hu8G6 versão 2 (SEQ ID NO:76)
EIVLTQSPATLSLSPGERATLSCRASQSVSTSSYSYMYWYQQKPGQAP RLLIKYASNLESGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQHNWEI PFTFGGGTKVEIK
cadeia leve hu8G6 versão 3 (SEQ ID NO:77)
EIVLTQSPATLSLSPGERATLSCRASQSVSTSSYSYMYWYQQKPGQAP RLLIKYASNLESGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQHNWEI PFTFGGGTKVEIK
A seguir são descritas as retromutações na cadeia leve variável remodelada:
E1 D - Esta tem mostrado influenciar a conformação de CDR/ ligação de antígeno (Kolbinger et al., Protein Eng., 8:971 -980 (1993)). No modelo, ela pode interagir com a cadeia principal ou cadeias laterais de S26, Q27 e/ou E93 nas CDRs L1 e L2. Ela é removida nas versões 2 e 3 já que a substituição é conservativa.
L46F - Esta é um resíduo de interface de empacotamento

VH/VL. Ela também aparece à direita e embaixo do resíduo E55 da CDR-L2. Ela é removida na versão 3.
Y49K - Esta é adjacente à CDR-L2 e parece estar interagindo com o resíduo E55 no modelo. Essa tem a probabilidade de ser uma retro-mutação muito importante e, portanto, não é removida.
A seguir são descritas as retromutações na cadeia pesada variável remodelada:

A24G - Essa é um resíduo canónico para CDR-H1. Mutação conservativa. Removida na versão 2.
G26S - Essa é um resíduo canónico para CDR-H1. Mutação conservativa. Removida na versão 2.
Q39L - Essa é um resíduo de interface de empacotamento. Tem uma interação bastante limitada com a cadeia leve e, portanto, é removida na versão 2. M481 - esta é uma retromutação comum. No modelo, ela pode interagir com Y59 e F63 na CDR-H2. É dispensada na versão 3. V68A - Este resíduo está localizado abaixo da CDR-H2, possivelmente interagindo com Y59 e F63.
R72V - Este é um resíduo canónico para CDR-H2 T74K. Esse resíduo está localizado debaixo da CDR-H2, possivelmente interagindo com Y53 ou contatando diretamente o antígeno.
Exemplo 8: internalização do anticorpo α κ
Anticorpos que são internalizados por células oferecem uma vantagem para certas indicações clínicas tal como câncer, porque os anticorpos podem ser então conjugados com toxinas, compostos radioativos ou outros agentes anticâncer para direcionar seletivamente e inibir o crescimento de células cancerosas. A capacidade dos anticorpos anti-ocvP6 de serem internalizados foi previamente descrita em WO 03/100033, aqui incorporado, a título de referência, em sua totalidade. WO 03/100033 descreve que a internalização foi observada para anticorpos monoclonais dependentes de cá-tion (miméticos de ligante contendo RGD) tais como 6.8G6 e 6.1 A8. Contudo, não foi observada internalização para mAbs independentes de cátion, tais como 6.3G9, 7.1C5 e 6.4B4. A capacidade de um anticorpo de ser inter-nalizado por células, tal como 8G6, acarreta a vantagem de acoplar o anticorpo internalizante com porções/agentes terapêuticos para permitir a distribuição das porções/agentes na célula. Por exemplo, fármaco ou porções de toxina podem ser conjugados ao anticorpo internalizante 8G6. Contudo, essa mesma aplicação pode ser aplicada aos anticorpos não internalizantes, tal como 3G9, em que uma porção química pode ser conjugada a tais anticorpos para permitir a distribuição para a superfície da célula de um alvo (por exemplo, superfície da célula tumoral).
EXEMPLO 9: otvBe é Altamente Expressa em Metástase Relativa a Tumores Primários
Nos presentes experimentos, foi estabelecido o estudo da expressão de Ονβθ em uma variedade de cânceres de origem epitelial e em lesões metastáticas e para determinar se o bloqueio da função de ανββ mAbs inibiria o crescimento de tumores que expressam ο ββ in vivo. Avaliou-se a atividade antitumoral in vitro e in vivo de nosso Ονββ mAbs antihumanos em um carcinoma faríngeo humano, Detroit62, e comparou-se este à atividade antitumoral in vivo de ΤβΡιΙΙ:Ρα Os dados suportam um papel em câncer humano para Ονββ e potencial para intervenção terapêutica com bloqueio de função de ανββ mAbs.
A. Materiais e Métodos:
Para imunoistoquímica, seções de tecido foram desparafinizadas em xileno e etanol, reidratadas em água destilada, e então imersas em metanol com 0,45% de H2O. Os tecidos foram incubados com pepsina (00-3009), Zymed, São Francisco, CA) e bloqueados com avidina e biotina (SP-2001 : Vector Laboratories, Burlingame, CA). O anticorpo primário foi diluído em solução salina tamponada com fosfato (PBS) contendo 0,1% de albumina de soro bovino (BSA) e os tecidos foram incubados durante a noite a 4°C. Para imunoçoloração de β6 em tecido de xenoenxerto de camundongo, seções foram incubadas com uma forma quimérica humana/camundongo do mAb anti-o^e, 2A1 (Weinreb, P.H. et al., J. Biol. Chem. 279(17): 17875-17887 (2004), e um anticorpo secundário, biotinilado, antihumano (PK-6103, Vector Laboratories, Burlingame, CA). Para imunoçoloração de β6 em tecido humano, seções foram incubadas com 2A1 murino e um anticorpo secundário biotinilado anticamundongo (PK-6102, Vector Laboratories). Complexo de avidina-biotina-raiz forte peroxidase (Kit Vector, PK-6102) foi aplicada às seções, incubadas por 30 minutos à temperatura ambiente, e substrato de 3,3'-diaminobenzidina (DAB) foi preparado conforme instruções (SK-4100, Vector Laboratories) e aplicado às seções, por cinco minutos, à temperatura ambiente. Seções de tecido foram coloridas com Hematoxilina de Mayer, por 1 minuto e rinsadas em água e PBS.
B. Resultados:
1. Expressão de ανββ em Metástases
Imunocoloração de ανβε foi avaliada em uma variedade de metástases tumorais, 78% das metástases (43/55) foram positivamente imuno- coloridas, mostrando coloração intensa na maioria das metástases (figura 13A-F; figuras 14A-I). Verificou-se que esse resultado é um aumento do percentual de imunocoloração positiva em que somente os cânceres da cabeça e do pescoço, cervicais e pancreáticos mostraram um nível equivalente de expressão (Tabela 1 ):
Tabela 1 : Expressão de ανββ em Tumores Humanos (imunoistoquímica)

Tecido oypeVtotal % Ονβ6+
Oral 4/4 100%
Cervical 79/98 81 %
Pâncreas 31/39 80%
Pele 41/53 77%
Laringe & faringe 43/64 67%
Esofágico 35/56 63%
Endométrio 17/32 53%
Pulmão 28/70 40%
Mama 41/101 41%
Colorretal 181/488 37%
2. Expressão de θνβ6 em Tumores do Endométrio e Metástases Emparelhadas com os Pacientes
Como notado na Tabela 1 , acima, imunocoloração de θνβ6 foi positiva em 53% dos tumores do endométrio examinados. Com poucas ex-ceções, a coloração era mais proeminente em regiões mais invasivas de tumores de grau mais alto. Três amostras de tumor primário haviam emparelhado com a metástase de linfonodo. Em dois desses casos, a imunocoloração foi significantemente maior nas metástases de linfonodos com relação ao tumor primário emparelhado (comparar figura 15A com a figura 15B, e a figura 15C com a figura 15D). No terceiro caso, a imunocoloração foi alta em ambas as metástases de linfonodo e o tumor primário emparelhado (dados não mostrados). O percentual de coloração de epitélio tumoral positivo em ανβθ nos três tumores primários era de 10%, 20% e 90%, respectivamente, enquanto o percentual no epitélio tumoral positivo para ανββ positivo nos lin-fonodos metastáticos emparelhados era 80%, 100% e 100%, respectivamente. No endométrio normal, a coloração ficou confinada a células ocasionais na camada da superfície, bem como em cistos.
3. Expressão de Ονββ em Amostras de Tumor da Mama Humano

Invasivo
Mais que 100 amostras de câncer da mama humano foram avaliadas quanto ao nível de expressão de Ονββ usando imunoistoquímica, de acordo com os procedimentos descritos acima em Materiais e Métodos. Em vários casos de carcinoma ductal in situ (DCIS), a expressão de ονββ foi limitada ao mioepitélio circundando o tumor e não observada no próprio tumor (vide, por exemplo, BrCa19, figura 6A). Contudo, em vários casos de carcinoma da mama invasivo, νββ foi expressa também no tumor (vide, por e-xemplo, BrCa23, figura 16B).
Há evidência de que a expressão de genes específicos em células de tecido da mama (células epiteliais, células mioepiteliais, e fibroblastos) é alterada em comparação com o tecido de mama normal, para tecido de mama contendo um tumor não invasivo tal como DCIS, para um tecido de mama contendo um carcinoma de mama invasivo (Alinen, M. et al., Câncer Celi 6:17-32 (2004); Burstein, H.J. et al., N. Engl. J. Med. 350:1430-1441 (2004)). Muitas dessas alterações de expressão de genes foram detectadas nas células mioepiteliais. É possível que a expressão da integrina θνββ no mioepitélio (tanto no tecido normal como no DCIS) proporcione um micro-ambiente, talvez através da ativação localizada de TGF-β, suportando a viabilidade tumoral, e promovendo a progressão de um tumor invasivo. Um modelo in vivo de DCIS que pode progredir para um carcinoma invasivo, tal como MCF10DCIS. Com (Miller, F.R. et al., J. Natl. Cane. Inst. 92:1 185-1186 (2000)), proporcionaria um método para avaliar a expressão de ανββ dentro do contexto de um tumor da massa progressivo. Poder-se-ia avaliar a ex- pressão de θνβ6 no mioepitélio no estágio precoce não invasivo do tumor e expressão de ανββ conforme o tumor progride para um fenótipo invasivo in vivo. Esse modelo permitiria também que se testasse o papel funcional de ανββ usando θνβ6 mAbs de bloqueio e também testar a eficácia de mAbs an-

4. Expressão de Ονββ em Amostras de Tumores Pancreáticos Humanos, Metástases Emparelhadas com Pacientes e Modelo de Xenoenxerto de Camundongo de Tumor Pancreático Invasivo
Como notado na Tabela 1 , a imunocoloração de θνβ6 foi positiva em 80% dos tumores pancreáticos humanos. Quando amostras de tumores pancreáticos humanos de oito pacientes diferentes foram examinadas por imunoistoquímica, a coloração foi proeminente em regiões invasivas de tumores de alto grau (figuras 17A-17C; 18A-18E). As amostras de tumores primários tinham também metástases de linfonodos emparelhadas (figuras 17D-17F; 18F-18J), que também demonstraram forte coloração de οονββ, suportando a noção que células positivas para ανββ haviam disseminado do sítio de tumor primário. Em pâncreas normal (figuras 17G-17H; 18K-18L), a coloração ficou confinada a células ocasionais na camada da superfície.
Para subsequentemente examinar as influências da expressão de Ονββ na invasão de células tumorais, usou-se um xenoenxerto de tumor de camundongo BxPC-3 como um modelo de adenocarcinoma pancreático humano. Os animais foram implantados (dia 0) subcutaneamente no flanco com 5 x 106 células/camundongo, suspensas em solução salina estéril, u-sando uma injeção de 0,1 mLVcamundongo. No dia 30, os camundongos com tumores estabelecidos (-60-100 mm3) foram emparelhados em pares para cada três grupos de tratamento (PBS; mAb 3G9; proteína de fusão de ll-lg de receptor de TGF-β solúvel (εοΠΌΡβΡιΙΙ-Ρο)) para todos os estudos. Os agentes de teste foram administrados aos camundongos por meio de intraperitoneal em um esquema de tratamento de 3 vezes por semana. Os camundongos foram injetados com 3G9 a 10 mg/kg, εοΓΓΌΡβΡιΙΙ-Ρο a 2 mg/kg, ou PBS (controle negativo). O crescimento do tumor foi medido duas vezes na semana e o volume do tumor foi estimado de acordo com a fórmu- la: [(largura)2 x comprimento]/2. Os tumores dos grupos de tratamento foram excisados, fixados em 10% de paraformaldeído, embutidos em parafina e seccionados para análise imunoistoquímica usando o mAb 6.2A1 quimérico v6 não bloqueador.
O tratamento com mAB 3G9 anti-a^ teve efeito direto no crescimento do tumor (figuras 19B, 19C), com crescimento do tumor significantemente reduzido depois de cerca de 48 dias de tratamento com o anticorpo. O nível de inibição de crescimento observado com solTGFpRII-Fc foi algo inferior àquele observado para 3G9. Esses resultados indicam que o mAb 3G9 anti-otv 6 inibe o crescimento do tumor em um modelo de xénoenxerto de câncer pancreático humano, e sugerem que tais anticorpos bloqueadores devem ser úteis em inibir o crescimento do tumor, e por extensão da invasão do tumor, em adenocarcinomas pancreáticos humanos primários.
EXEMPLO 10: mAbs de Bloqueio de Função de ανββ Inibem Migração de Célula Tumoral, Invasão e Produção de MMP de Células Tumorais que Expressam (Χνββ
O anticorpo monoclonal de bloqueio de θνβ6 (mAb) 3G9 (Wein-reb. P.H. et al., J. Biol. Chem. 279(17): 17875- 17887 (2004)), e TGF-pRII-lg (Cosgrove, D. et al., Am. J. Pathol. 157(5):1649-1659 (2000)), foram avaliados quanto à sua habilidade de bloquear a capacidade de células transfec-tadas com β6 de invadir, migrar, e produzir metaloproteinase de matriz 9 (MMP-9) in vitro. Essas atividades foram monitoradas como se cada uma tivesse sido associada à invasão e migração de células tumorais. Os efeitos de 3G9 e TGF-pRII-lg foram avaliados usando células parentes não trans-fectadas (C1 ) e um derivado transfectado com ββ de células C1 (VB6).
Ensaio de Migração e Invasão. Células escamosas de carcinoma foram crescidas em meios KGM como previamente descrito (Thomas, G.J. et al., J. Invest. Derm. 117(1):67-73 (2001 ). Para medir a migração, u-sou-se placas FLUOROBLOK® e inserções (BD Biosciences; Bedford, MA) de acordo com as instruções do fabricante. Em resumo, as cavidades vazias foram preenchidas com meios KGM ou KGM isento de soro como controle negativo. As células foram colhidas em meios isentos de soro com anticorpo e pré-incubadas em meios isentos de soro com anticorpo. 50.000 células foram adicionadas à inserção, que foi então colocada dentro das cavidades e incubada por 24 horas, a 37°C, em uma incubadora de cultura de tecido. Depois da incubação, as células e os meios foram removidos do topo da in- serção. As células que migraram para a parte de baixo do filtro foram quantificadas por marcação com 2 μg/mL de Calceína (Invitrogen Corp., Carlsbad, CA), por 1 hora e medição da fluorescência em modo de leitura de fundo. O percentual de inibição foi calculado como o decréscimo do número de células migradas em presença do anticorpo em comparação com os meios sozi- nhos. A invasão foi medida de um modo similar, usando inserções de FLU- ROBLOK revestidos com MATRIGEL® e incubação por 48 horas.
Quantificação de Produção de MMP. Células, em meios contendo 1 % de FBS, foram cultivadas em cavidades revestidos com MATRIGEL (BD Biosciences) pelo tempo indicado. Os sobrenadantes foram colhidos, centrifugados para remover os fragmentos de células, e congelados até serem ensaiados. Os níveis de MMP foram quantificados por ELISA (R&D Systems, Minneapolis, MN).
Resultados:
Como mostrado nas figuras 20A-20C, o mAb 3G9 de bloqueio de ανββ inibiu significantemente a migração, invasão e produção de MMP-9 por células VB6 in vitro. O bloqueio da atividade de TGF-β com TGF^RII-lg recombinante também inibiu a invasão e produção de MMP-9 por células VB6 (figuras 20B e 20C), mas não afetou sua migração (figura 21 A). Esses dados mostram uma diferença funcional distinta comparando o bloqueio de função de θνβ6 versus bloqueio de atividade de TGF-β. Essa conclusão é consistente com a capacidade de Ονβε de mediar tanto a adesão como a migração celular através da ligação à fibronectina, bem como a ativação de precursor latente TGF-β (Sheppard, D., Câncer Metast. Rev. 24:395-402 (2005)).

Exemplo 1 1 : Ονββ mAb Inibe a Invasão Estromal em Modelo de Xenoenxerto de Câncer Colorretal Humano (LIM1863)
1 . antecedente
Um novo modelo de carcinoma de cólon, LIM1863, foi recentemente caracterizado (Bates, R.C. e Mercúrio, A. M., Mol. Biol. Celi 14:1790- 1800 (2003); Bates, R.C, et al., J. Clin. Invest. 1 15(2):339-347 (2005)). In vitro, células LIM1863 cresceram em uma cultura de suspensão em esferói- des 3D (organóides) bem-diferenciados. Contudo, depois de exposição a TGF-β e TNFoc, essa linhagem de célula se converte em um fenótipo de mo- nocamada migratório, com alterações morfológicas características de uma transição epitelial para mesenquimal (EMT), tipificada pela perda de E-caderina. Essa transição é acompanhada por um aumento significante da expressão de ανβ6. In vivo, as células LIM1863 são tumorigênicas quando injetadas subcutaneamente no flanco de camundongos NUS (Bates, R.C. et al., J. Clin. Invest. 1 15(2):339-347 (2005)). Como demonstrado na figura 6, as células LIM1863 exibem um marcante padrão de expressão de ανββ (id.). Especificamente, a expressão de Ονββ é particularmente proeminente nas células que parecem ter invadido a massa de tumor primário no estroma tu-moral. Essa constatação é coerente com a noção que essas células têm sofrido transição epitelial mesenquimal (EMT) que foi previamente descrita (vide id.). - Portanto, escolheu-se usar as células LIM1863 como um modelo de xenoenxerto de câncer colorretal humano para examinar o possível envolvimento de Ονβε na invasão estromal neste modelo.
2. Materiais e Métodos
As células LIM1863 foram crescidas como organóides em RPMI-1640 (GIBCO, Invitrogen Corp., La Jolla, CA) suplementado com 5% de soro de bezerro fetal (FCS). Os organóides LIM1863 (aproximadamente 8 x 106 células) foram inoculadas subcutaneamente nos flancos de camundongos fêmeas nus. Todos os estudos com animal foram aprovados pelo Institutio-nal Animal Care and Use Committee (IACUC) da Biogen Idec. Os camundongos foram tratados por injeção intraperitoneal três vezes na semana com 10 mg/kg de anticorpo monoclonal murino 3G9 específico
(Wein- reb, P.H. et al., J. Biol. Chem. 279(17):1785-17887 (2004)), 2 mg/kg de proteína de fusão TGF- RII-lg, solúvel, recombinante (Cosgrove, D. et al., Am. J. Pathol. 157(5):1649-1659 (2000)), ou controle de veículo (PBS). Os volumes de tumor foram medidos nos pontos de tempo correspondentes usando um calibrador, e o volume de tumor foi calculado usando a fórmula (L x W2)/2. Xenoenxertos foram colhidos sete semanas mais tarde, e seções fixadas com formalina e embutidas em parafina foram usadas para imunoistoquímica, que foi realizada conforme descrição acima no Exemplo 9 (figura 21 ).
Resultados
mAb anti-cxvP6 3G9 e/ou TGF^RII-lg solúvel, recombinante, não exerceram nenhum efeito direto no crescimento do tumor (figuras 22A, 22B). Contudo, esses ligantes inibiram significantemente a invasão estromal de células LIM1863 por aproximadamente 80% (figura 22C), conforme avaliação por quantificação das áreas de células tumorais positivas para Ονββ dentro do estroma (figura 22D-22F), realizada por um patologista cego para o tratamento..
EXEMPLO 12: Afinidade e Bioatividade de 6.3GA9 murino (m3G9) para In-teqrina α * Expressa em Células de Primatas Não Humanos
SUMÁRIO. A afinidade e a bioatividade do anticorpo monoclonal 6.3G9 (m3G9) de bloqueio
em integrina Ονββ de primata não humano (NHP) foram determinadas através de uma variedade de métodos in vitro. Usando classificação de células ativadas por fluorescência (FACS), as linhagens de células de NHP expressando altos níveis de θνβ6 foram identificadas a partir de 2 espécies diferentes (12MBr6 do macaco verde africano, e 4MBr5 do macaco rhesus). m3G9 ligado a θνβ6 expressa em 12MBr6 e 4BBr5 com valores de ED50 de 0,030 g/mL e 0,38 μg/mL, respectivamente. i7i3G9 também inibiu a ligação de 12MBr6 e 4MBr5 ao peptídeo (LAP) associado à latência de ΤβΡμβΙ com valores de IC5o de 0,22 g/mL e 0,29 μg/mL, respectivamente. Finalmente, m3G9 bloqueou a habilidade da linhagem de célula 4MBr5 de ativar TGFfi latente, conforme determinação usando um ensaio de co-cultura com células epiteliais de pulmão de mink res- ponsivas a TGF expressando estavelmente uma porção do promotor de inibidor 1 ativador de plasminogênio (TMLC), com um valor de IC5o de 0,31 g/mL
INTRODUÇÃO. O propósito desse estudo foi de determinar a afinidade e a bioatividade do anticorpo monoclonal
6.3G9(m3G9) para integrina ανββ expressa em células de primata não humano (NHP). m3G9 é o precursor murino do anticorpo monoclonal humanizado hu3G9 (BG0001 ). Esse anticorpo murino tem um reagente marcado com integrina Ονββ específico, com alta afinidade.1 m3G9 se liga a seu alvo, a integrina Ονββ, com alta afinidade (KD = 16 pM), inibe a ligação de Ονββ expressa em célula a ligantes (peptídeo associado à latência (LAP) de ΤβΡβΙ e fibronec-tina), e bloqueia a capacidade de θνββ de ativar TGF latente.1 O anticorpo requer a presença tanto de av como de subunidades β6 para ligação, e não foi observada nenhuma reatividade cruzada a outras integrinas relacionadas (ανβ3, ανβ3, ανβ5, ανβ3, e. llb 3), indicando que m3G9 é altamente específico para άνββ· 1
Integrinas β6 murinas e humanas têm um alto grau de similaridade de sequências (identidade de 89,5%)2, assim como as integrinas av murinas e humanas (92,8% de identidade)3. A sequência de Ονββ de NHP não foi determinada, mas seria também esperado que compartilhasse um alto nível de identidade de sequências.
De modo a determinar a afinidade de m3G9 para ανββ de NHP, a ligação foi medida por FACS. A capacidade de m3G9 de bloquear adesão celular a LAP de ΤβΡβΙ humano foi avaliada em um ensaio de adesão celular. Finalmente, a capacidade de m3G9 de bloquear a ativação mediada por θνβ6 de NHP de TGF latente foi determinada usando um ensaio de co-cultura.
Materiais e Métodos
Reagentes. Os anticorpos monoclonais de camundongo 6.3G9 (m3G9) e 6.4B4 foram gerados e purificados conforme descrito na ref. 1 e acima. LAP (LAP) humano recombinante foi adquirido da R&D Systems (catálogo N2 246-LP). A linhagem de células SW480 (adenocarcinoma colorretal humano) transfectada com β6 humano (SW480 6) foi fornecida por Dean Sheppard (UCSF).
Linhagens de Células de NHP. As seguintes linhagens de células foram obtidas da American Type Culture Collection (ATTCC):

Nome Espécie da Fonte Tipo de Célula Idade da Fonte
Vero Macaco Verde epitelial do rim adulto
Africano
12MBr6 Macaco Verde epitelial do pulmão 2-3 anos de idade, macho
Africano
LLC-MK2 Macaco Rhesus epitelial do rim adulto
4MBr5 Macaco Rhesus epitelial do pulmão 2-3 anos de idade
Classificação de Células Ativadas por Fluorescência (FACS). As células foram colhidas por tripsinização, lavadas uma vez com solução salina tamponada com fosfato, e então ressuspensas em tampão de FC (PBS, 2% de FBS, 0,1 % de NaN3, CaCI2 1 mM, e MgCI2 1 mM). 1 x 106 células foram então incubadas com 10 μg/mL de m3G9 em gelo por 0,5 h em um total de 50 μΙ_ de tampão FC. Depois da incubação, as células foram lavadas duas vezes com tampão FACS gelado (PBS, 2% de FBS, 0,1 % de NaN3) e ressuspensas em 100 μ!_ de tampão FC contendo uma diluição 1 :200 de IgG de anticamundongo de cabra conjugado com Alexa488 (Jackson Immuno-Reséarch) e incubadas no gelo por 30 minutos. As células foram lavadas duas vezes com tampão FC gelado e ressuspensas em 100 μΙ_ de tampão FC e 50 μΙ_ de 4% de paraformaldeído. Ligação do anticorpo secundário marcado foi monitorada por citometría de fluxo (Biogen Idec Research Core Facility).
Ensaio de Adesão Celular. Uma placa de microtitulação de 96 cavidades foi revestida com 50 μΙ-ycavidade de 0,5 μί. de LAP diluído em bicarbonato de sódio 50mM, pH 9,2, a 4°C durante a noite. A placa foi lavada duas vezes com PBS (100 μί), bloqueada com BSA a 1 % em PBS (100 μUcavidade) por 1 hora, a 25°C, e lavada duas vezes com 100 μL/ca idade de tampão de ensaio (Tris 50mM, pH 7,5, NaCÍ 150mM, CaCI2 1 mM, MgCI2 1 mM). Células 12MBr6 ou 4MBr5 (4-12 x 106 células/mL) foram incubadas com corante fluorescente 2μΜ (BCECF-AM, Sondas Moleculares) em tampão de ensaio com agitação suave em banho de água, por 15 minutos, cole- tadas por centrifugação, e ressuspensas em tampão de ensaio para 4-12 x 106 células/mL. Para células individuais da placa lavada foram adicionados 25 μΙ_ de m3G9, duas vezes concentrado e 25 μΙ_ de células marcadas, e a placa foi incubada a 25°C por 0,5 hora. A placa foi lavada de 4 a 6 vezes com tampão de ensaio (100 μΐ. cavidade) e o corante fluorescente, devido às células capturadas na placa, foi registrada em um leitor de placas de fluorescência com 96 cavidades (CytoFluor Série 4000, Perspective Biosys-tems). O percentual de ligação foi determinado por comparação da fluorescência antes da etapa de lavagem final (isto é todas as células adicionadas) àquela depois da lavagem (isto é células ligadas).
Ensaio de co-cultura. TMLC (linhagem de células epiteliais do pulmão de mink Mv 1 Lu, estavelmente transfectadas com proteína de inibidor 1 ativador de palsminogênio)4 foram crescidas em DMEM + 10% de soro bovino fetal com 2mM de L-glutamina, penicilina-estreptomicina e 200 μg/mL de G418. As células foram elevadas dos frascos com PBS + EDTA 5mM, lavadas com PBS + 0,1% de BSA, contadas por hemocitômetro e plaqueadas em placas de 96 cavidades. Células de expressão de Ονββ foram armazenadas em gelo por 2 horas enquanto TMLC eram plaqueadas em placas de 96 cavidades a 104 células/cavidade em DMEM + 0,1% de FBS e deixadas aderirem a 37°C, depois do que as TMLC foram lavadas com DMEM + 0,1% de BSA. Os anticorpos monoclonais foram diluídos em DMEM + 0,1% de BSA, adicionados às células de expressão de Ονββ e pré-incubados por 20 minutos à temperatura ambiente. As células de expressão de ανββ foram então adicionadas às TMLC a 4 x 10 /cavidade em DMEM + 0,1% de BSA (100 μL/cavidade). As placas foram incubadas por 20 horas a 37°C, em uma incubadora umidificada, enriquecida com CO2. O sobrenadante foi descartado e reposto com 100 μί de PBS + Ca+2 1 mM e Mg" 1mM. As células foram lisadas e luciferase foi detectada com um kit LucLite (Perkin Élmer Life Sciences, Boston, MA) usando um luminômetro de microplaca (luminômetro de microplaca Tropix TR717, Perkin Élmer Life Sciences).

Resultados:
1 . Afinidade por ligação e bloqueio de potência de 6.3G9 de camundongo (m3G9) para integrina θνβ6 de primata. De modo a estudar a afinidade de m3G9 por integrina Ονββ de primata não humano (NHP), quatro linhagens de células de NHP foram obtidas de ATCC. Uma triagem inicial (figura 23) indicou que a expressão de Ονββ era maior nas linhagens de células 12MBr6 e 4MBr5, de modo que estas duas linhagens foram usadas para a caracterização de m3G9. Um anticorpo de não bloqueio de (Χνβ6, 6.4B4, também se ligou à 12MBr6 e 4MBr5 com uma intensidade de fluorescência média similar à observada para m3G9.
1 .1 Ligação à integrina expressa na célula (FACS). A ligação de m3G9 à 12MBr6 e 4MBr5 foi medida usando classificação de células ativa-das por fluorescência (FACS) conforme descrição em Materiais e Métodos. Uma titulação inteira de m3G9 foi realizada em cada linhagem de células, e uma ED50 (concentração de anticorpo dando um sinal semimáximo) foi determinada usando regressão não linear. Os valores de ED50 para 12MBr6 e 4MBr5 foram 0,30 μg/mL (figura 24A) e 0,38 μg/mL (figura 24B), respectivamente.
1 .2. Adesão celular a LAP. As habilidades de 12MBr 6 e 4MBr 5 de se ligarem ao LAP foram demonstradas usando um ensaio de adesão celular. Essa adesão foi bloqueada por m3G9, mas não por uma proteína de controle (BSA) ou por um anticorpo não bloqueador de θνβ6 (6.4B4) (figura 25). A potência de m3G9 para bloquear essa interação foi avaliada por medição da dependência de concentração de inibição em cada linhagem de célula (figura 26). Desses experimentos, uma IC50 (concentração de anticorpo dando inibição semi-máxima). Os valores de IC50 para 12MBr6 e 4MBr5 eram de 0,22 μg/mL e 0,29 μg/mL, respectivamente.
1 .3. Ativação de TGF (Ensaio de Co-cultura). As capacidades de 12MBr6 e 4MBr5 para ativar TGFfi latente foram determinadas usando um ensaio de co-cultura, em que as células são incubadas com células repórter epiteliais de pulmão de mink responsivas a TGFfi que expressam es-tavelmente uma porção do promotor de inibidor 1 ativador de plasminogênio (TMLC) (figura 27). A expressão de θνβ6 não é suficiente para promover TGF , já que diferenças na sinalização intracelular e/ou na produção de TGF latente impactarão também a atividade neste ensaio. Dessas duas linhagens de célula, somente a de 4MBr5 foi eficaz na ativação de TGF latente, enquanto a de 12MBr5 não mostrou nenhum efeito. A ativação foi também observada usando a linha de célula de controle positivo SW480P6, uma linhagem de células de carcinoma de cólon humano transfectada com β6. A linhagem de célula de controle não parental não transfectada (SW480) não mostrou ativação, como se esperava.
A capacidade de m3G9 de bloquear ativação de . TGF por 4MBr5 foi medida no mesmo experimento. A ativação de TGF foi bloqueada pela adição de m3G9 em 1 μg/mL ou 10 μg/mL, mas não pela adição do anticorpo 6.4B4
não bloqueador. O efeito inibidor sobre as células 4MBr5 de m3G9 nestas concentrações foi similar ao observado usando a linhagem de células SW480p6. Em um experimento separado, foi determinada a dependência de dose de inibição de m3G9 de ativação de TGFp mediada por 4MBr5 (figura 28). Os valores de IC50 para 4MBr5 e SW480 6 foram 0,31 μg/mL e 0,37 μg/mL, respectivamente.
2. Comparação de Afinidade por m3G9 Através das Espécies. Os dados gerados para ligação e atividade de m3G9 em camundongo, ανββ de NHP e humano estão sumarizados na Tabela a seguir. A primeira coluna na Tabela mostra as ED5oS de ligação determinadas por FACS. Em cada caso, a ED50 medida era <0,38 μg/mL (2,5 nM). A segunda coluna na Tabela mostra a IC50 para inibição de adesão celular por m3G9. Em cada caso, m3G9 bloqueou a adesão celular com uma IC50 de <0,29 μg/mL (1 ,9nM). A terceira coluna na Tabela mostra a IC50 para inibição da ativação de TGF mediada por ο ββ. conforme determinada usando-se o ensaio de co-cultura. A linhagem de células do NHP 4MBr5 mostrou atividade celular similar à linhagem de células humanas 8\Λ 480β6 (valores de IC50 de 0,40 de 0,24 μg/mL, respectivamente).
Comparação da atividade de m3G9 usando linhagens de células de camundongo, de NHP e humanas Espécie Linhagem Ligação Adesão Co-cultura
de célula (FACS), Celular, IC5o, g/mL . ED5Q, g/mL IC50, g/mL
Camundongo ΝΙΗ3Τ3β6 0,30 a n,d," n,d,
FDC-ΡΙββ n,d, 0,02 a n,d,

NHP 4 M Br 5 0,30 0,22 0,31
12MBr6 0,38 0,29 n,d,

Humano SW4S0 6 0,05 a 0,03 0,37
Detroit562 n,d, 0,04 n,d,
SCC- 14 n,d, 0,16 n,d, a ref. 1
b n.d. não determinada
3. referências
1. Weinreb, P.H. et ai, J. Biol. Chem, 2004, 279, 17875-87.
2. Arend, LJ. et ai, J Am. Soe. Nephrol. 2000, 11 , 2297-305.
3. Wada, J. et ai, J. Celi Biol., 1996, 132, 1161 -76.
4. Abe, M. er a/, Anal. Biochem., 1994, 216, 276-84.
EXEMPLO 13: Efeitos de mAbs anti-OyPg murinos em camundongos de Alport (Col4A3-A)
SUMÁRIO: ο βε é uma integrina induzível por TGF-β que é preferencialmente expressa em sítios de remodelação epitelial e tem mostrado ligar e ativar precursor latente TGF-β. Aqui, mostrou-se que ο ββ é superex-pressa em epitélio de rim humano na glomerulonefrite membranosa, diabetes melito, nefropatia por IgA, síndrome de Goodpasture, e epitélio renal de Alport. Para avaliar o papel regulador potencial de ανββ na doença renal, temos estudado os efeitos de a^mAbs bloqueador de função e ablação genética da subunidade β6 em fibrose renal em camundongos Col4A3-/-, um modelo de camundongo de síndrome de Alport. A expressão de ανββ em rins de camundongo de Alport foi observada principalmente em células epiteliais tubulares corticais e correlacionadas com a progressão de fibrose. O tratamento com mAb bloqueador de ο ββ inibiu o acúmulo de fibroblastos ativa-dos e deposição de matriz de colágeno intersticial. Inibição similar de fibrose renal foi observada em camundongos de Alport com deficiência de β6. A caracterização de transcritos de rim mostrou que mAbs bloqueadores de θνββ inibiram significantemente alterações associadas a tecidos do rim na expressão de mediadores fibróticos e inflamatórios. Padrões similares de modulação de transcritos foram produzidos com tratamento com TGF-β Rll sugerindo funções reguladoras compartilhadas de ανβ6 e TGF-β. Essas constatações demonstram que θνβ6 pode contribuir para a regulação da fibrose renal e sugerem esta integrina como sendo um alvo terapêutico potencial.
INTRODUÇÃO:
Fibrose progressiva é um processo comum que leva ao desenvolvimento da doença renal para o estágio final promovido por remodelação epitelial, ativação de fibroblastos, inflamação e reorganização de interações celulares com a matriz extracelular (ECM). Mecanismos moleculares que contribuem para esses eventos e incluem a regulação errónea do eixo TGF-β, remodelação de ECM aberrante, e expressão e função alteradas de receptores de adesão celular da superfamília de integrinas 1"5. Estudos recentes têm revelado importantes funções reguladoras de várias integrinas e moléculas associadas em células epiteliais renais e mesenquimais 36"8.
Dentre as integrinas cuja expressão é fortemente aumentada na doença renal é a integrina ανββ induzível por TGF-β5'9'10. A expressão de ( νββ está geralmente restrita às células epiteliais, onde ela é expressa em baixos níveis em tecidos adultos normais durante o desenvolvimento, lesão, e neoplasia9,11"13. Embora θνβ6 seja expressa em níveis relativamente baixos em rim adulto saudável, sua expressão é proeminente no desenvolvimento do rim de camundongo, particularmente nos túbulos proximais, alça de Hen-le, e coleta de dutos '12,14. Recentemente, expressão elevada de θνββ foi reportada para várias formas de patologia do rim humano10.
Consistente com a expressão aumentada de ο ββ in vivo durante a remodelação de tecido, a expressão da integrina ανββ em células epiteliais cultivadas pode ser induzida por citocinas que regulam a remodelação epitelial, inclusive EGF e TGF-β5,9. Além disso, superexpressão de β6 na pele de camundongos transgênicos tem mostrado que provoca a formação de feri- mentos crónicos espontâneos15 sugerindo que ανββ pode desempenhar um importante papel na regulação da remodelação de tecido epitelial.
Ligantes conhecidos para θνβ6 incluem fibronectina, tenascina, e os peptídeos 1 e 3 associados à latência (LAP1 e LAP3), os fragmentos N- terminal das formas de precursor latente de TGF-βΙ e -β316"19. Como resultado da ligação a estes ligantes, θνβ6 pode mediar a adesão celular, disseminação, migração e ativação de TGF-β latente. TGF-β é sintetizado como uma proteína latente que é clivada e secretada com o LAP N-terminal não covalente mente associado à citocina TGF-β C-terminal, ativa, madura. O complexo de TGF-β latente não pode se ligar ao seu receptor cognato e assim permanece biologicamente inativo até ser convertido na forma ativa por um dos vários mecanismos que incluem clivagem por proteases, exposição a pH baixo ou radiação ionizante, e alterações conformacionais no complexo latente permitindo que ele se ligue a seus receptores cognatos20"22. Uma alteração ativadora conformacional pode ser induzida por ανββ envolvendo ligação direta da integrina a um motivo RGD contido nos LAP1 e LAP3. Essa ligação converte o precursor de TGF-β em um estado competente por ligação de receptor17'19. Essas constatações sugerem que a supra-regulação de expressão de θνββ na superfície das células epiteliais pode levar à ativação local de TGF-β seguida da ativação parácrina de eventos dependentes de TGF-β em células bystander. Isso incluiria a possibilidade de efeitos indiretoSj a jusante, sobre a atividade de TGF-β, que poderiam ser mediados por alteração de inflamação e fibrose inicialmente nos sítios de expressão de θνββ- Já que o TGF-β tem sido implicado como um regulador central de fibrose renal, formulamos a hipótese que sua ativação local por ανββ pode ser um importante processo no início e progressão de doença renal, e bloqueio de uma função do Ονββ poderia suprimir o desenvolvimento de fibrose renal. Nos estudos descritos aqui, mostramos que ανββ é altamente supra-regulado em um modelo de camundongo de fibrose renal e em amostras de rim humano com patologia fibrótica. Usando um modelo de camundongos Col4A3-/-, um modelo de doença renal progressiva similar àquela observada na síndrome de Alport humana, mostramos que mAbs bloqueando a ligação de ligante e as funções de ativação de TGF-β de ανββ , bem como a ablação genética de β6, inibem potencialmente tanto a fibrose giomerular como a tubulointersticial e retardam a destruição da arquitetura dos tecidos do rim. Mostrou-se que embora a integrina ανββ tenha restringido expressão no rim às células epiteliais tubulares, ela pode proporcionar efeitos protetores em sítios distais no tecido. Essas constatações fazem surgir a possibilidade que os efeitos antifibróticos podem ser também mediados através dos efeitos extra-renais indiretos além dos efeitos diretos de bloqueio de Ονββ nas células epiteliais tubulares. Estudos de tratamento retardados indicam que o blo-queio terapêutico de ανββ não somente inibe a progressão da fibrose renal, mas tem também o potencial de permitir a resolução de lesões fibróticas e-xistentes. A análise de assinaturas moleculares associadas à progressão de doença renal e afetadas por inibição de ανβ6 indica que o impacto terapêutico dos anticorpos bloqueadores de ανββ é similar àquele do bloqueio de TGF-β sistémico e está mecanicamente relacionado à atividade reduzida de TGF-β. Esses dados sugerem que ανββ está envolvido na regulação de fibrose renal e poderia proporcionar um novo alvo molecular para sua modulação terapêutica.
MATERIAIS E MÉTODOS:
1. Reagentes, ανββ mAbs foram gerados como previamente descritos aqui23. cDNAs de 2A1 e 3G9 quiméricos humanos/camundongo foram gerados a partir dos RNAs totais de hibridomas parentes respectivos com iniciadores de região constante CDL-739 para a cadeia pesada e CDL-738 para a cadeia leve usando o kit de Síntese de cDNA do Primeiro Filamento (Amersham/Pharmacia, Piscataway, NJ). Os genes de região variável de cadeia pesada e leve foram amplificados pela reação em cadeia de polime-rase usando os mesmos 3 iniciadores usados para a síntese de cDNA e uniões de iniciadores degenerados para a maioria das sequências de sinais de genes de anticorpos murinos (sequências disponíveis mediante solicitação) e Pfu DNA polimerase (Stratagene, La Jolla, CA). Regiões variáveis de cadeias leves e pesadas clonadas foram ligadas a vetores de expressão de mamíferos com regiões constantes de lgG1 humano. Proteína de fusão de receptor de TGF-β tipo II murino-lg (rsTGF-prll-lg) foi gerada como previamente descrito7 e adquirida da R&D Systems (532-R2, Minneaplois, MN). Os anticorpos foram adquiridos conforme indicado. mAb pan-anti-citoqueratina (C-11) conjugado com FITC, Sigma-Aldrich (F3418, St. Louis, MO); mAb de cadeia B1 anti-laminina (LT3), Chemicon (MAB1928, Temecula, CA); mAb anti-αν conjugado com ficoeritrina (PE) (RMV7), Chemicon (CBL1346P), an-ti-αν de coelho, Chemicon (AB1930); lgG1 de rato-PE, BD Biosciences (553925, San Jose, CA); e actina antimusculatura lisa (SMA)-Cy3, Sigma-Aldrich (C-6198). Identificamos anti-TGF-β policlonal de coelho, Santa Cruz Biotechnology (sc-146, Santa Cruz, CA) como um anticorpo que se liga preferencialmente a seções de xenoenxerto de células 293 expressando uma forma constitutivamente ativa de TGF-β em comparação com seções de xenoenxerto de células 293 expressando TGF-β latente24.
2. Animais. Camundongos Col4A3+/- de linhagem 129Sv/J foram obtidos de Dr. Dominique Cosgrove (Boy's Town National Research Hospital, Omaha, NE) e reproduzidos para gerar camundongos Col4A3-/- para estudos de injeção. Camundongos Beta6-/- de linhagem 129SV foram obtidos do Dr. Dean Sheppard (University of Califórnia, San Francisco, CA) e cruzados com camundongos Col4A3+/-. Todos os animais foram alojados em Biogen Idec e todos os estudos com animais foram aprovados e efetua-dos de acordo com o Institutional Animal Care and Use Committee.
3. Citometria de Fluxo. Células NIH3T3 (NIH3T3b6) estáveis transfectadas com β6 murino foram geradas conforme descrito previamente23. As células foram colhidas por tripsinização, lavadas em PBS, e ressus-pensas em tampão de FC (IX PBS, 2% de FBS, 0,1% de NaN3, CCI2 1 mM, e MgCI2 1 mM). 0,2 x 105 células foram incubadas em gelo por 1 hora em tampão de FC contendo anticorpos primários purificados em um volume total de 100 μL· Depois da incubação, as células foram lavadas duas vezes com tampão de FC gelado e ressuspensas em 100 μ!_ de tampão de FC contendo 5 μg/mL de IgG anticamundongo de burro conjugado com PE (Jackson ImmunoResearch). Para monitoramento da expressão de av, as células forma incubadas com um v anticamundongo de rato conjugado com PE (RMV-7) e um controle de lgG1 de rato conjugado com PE. As células foram lavadas duas vezes com tampão de FC gelado e ligação do anticorpo secundário marcado foi monitorada por citometria de fluxo.
Imunoistoquímica. Seções de tecido foram desparafinizadas em xileno e etanol, reidratadas em água destilada, e então imersas em metanol contendo 0,45% de H20. Os tecidos foram incubados com pepsina (00-3009, Zymed, San Francisco, CA) e bloqueados com avidina e biotina (SP-2001 ; Vector Laboratories, Burlingame, C). Anticorpo primário foi diluído em PBS contendo 0,1 % de BSA e os tecidos foram incubados durante a noite, a 4°C. Para imunocoloração de β6 em tecidq. de camundongo, as seções foram incubadas com uma forma quimérica humana/camundongo do mAb anti-ocvp6, 2AI23, e um anticorpo biotinilado antihumano (PK-6103, Vetor Laboratories, Burlingame, CA). Para imunocoloração de β6 em tecido humano, as seções foram incubadas com 2A1 murino23, e um anticorpo secundário biotinilado anticamundongo (PK-6102, Vector Laboratories). Complexo de avidina-biotina-raiz forte peroxidase (Vector Kit, PK-6102) foi aplicada às seções, incubadas por 30 minutos à temperatura ambiente, e substrato de 3,3'-diaminobenzidina (DAB) foi preparado conforme instruções (SK-4100, Vector Laboratories) e aplicado às seções por 5 minutos, à temperatura ambiente. Seções de tecido foram coloridas com Hematoxilina de Mayer por 1 minuto e rinsadas em água e PBS.
Seções de tecido congeladas embutidas em Composto O.C.T. (Cat. Ne 4583, Sakura Tokyo, Japão) foram fixadas em acetona e bloqueadas com 0,5% de caseína/0,05% de timerosal em PBS. Para imunocolora-ção de β6 em tecido, as seções foram incubadas com 2A1 murino23 e um anticorpo secundário de Alexa flúor 594 anticamundongo (A-11032, Sondas Moleculares Eugene, Oregon). Para imunocoloração de β6 em tecido de camundongo, as seções foram incubadas com uma forma quimérica de camundongo humano de 2A1 e um anticorpo secundário conjugado com Alexa flúor 594 antihumano (A-11014, Sondas Moleculares). Para imunocoloração de laminina e v, foi usado um anticorpo secundário conjugado com Alexa Flúor 88 de anti-rato (A-11006, Sondas Moleculares). Todos os outros anti- corpos foram diretamente conjugados como indicado previamente. Todas as imagens foram tomadas em 20X com exceção da figura 2A, que foi tomada em 40X. Todas as amostras de tecido humano foram obtidas sob aprovação de revisão institucional local e aprovação do paciente.
5. Quantificação de imunoistoquímica. Imunocoloração de SMA foi quantificada usando MetaMorph v5.0 (Universal Imaging Corporation, Sunnyvale, CA) e expressa como percentual positivo com relação ao tamanho de imagem total. Para cada animal, imagens de 20X de pelo menos 5 seções corticais e 1 a 5 medulares foram analisadas. Análise estatística dos grupos de tratamento foi efetuada usando ANOVA.
6. Tratamento de camundongos Col4A3-/- com mAb e rsTGF-PRII-lg. Camundongos Col4A3+/- em um background 129Sv/J foram reproduzidos para gerar camundongos Col4A3-/-. Os camundongos foram injeta-dos intraperitonealmente com proteínas, três vezes na semana, a partir das 3 semanas de idade até 7 ou 8,5 semanas de idade, conforme indicado. mAbs foram injetados intraperitonealmente em 4 mg/kg e rsTGF-pRII-lg foi injetado em 2 mg/kg. Os camundongos foram submetidos à eutanásia e os rins coletados para RNA e imunocoloração. Todos os estudos com animais foram aprovados e efetuados de acordo com o Institutional Animal Care and Use Committee.
7. Purificação de RNA total e síntese de cDNA.
Os rins foram homogeneizados diretamente em TRIzol (155-96-018, Invitrogen, Carslbad, CA) e RNA extraído de acordo com o protocolo do fabricante com extração adicional com 1 ml_ de fenol:clorofórmio:àlcool iso-amílico ácido em 25:24:1 , pH 6,6. O RNA total purificado foi re-suspenso em H2O tratada com pirocarbonato de dietila (DEPC) (Ambion Inc, Austin, TX) e 260 e 280 registrados (Spectra max Plus, Molecular Sieves, Sunnyvale, CA). DNA residual foi removido usando 5 unidades de grau de amplificação de DNase I (cat Ns 18068-015, Invitrogen) a 20°C, por 15 minutos. cDNA foi gerado usando um kit de arquivo de cDNA de alta capacidade de acordo com o protocolo do fabricante (cat N2 4322171 , Applied Biosystems Inc., Foster City, CA).

8. Desenho de iniciadores, sondas, e moldes padrão de oligonu- cleotídeos para Taqman. Iniciadores de oligonucleotídeos e sondas Taqman MGB foram designados de sequências de consenso Affymetrix usando Pri- mer Express versão 2.0.0 (Applied Biosystems Inc.). Sondas Taqman MGB foram desenhadas com um corante de repórter fluorescente (FAM) ligado covalentemente em 5' e um ("minor Groove binder")/finalizador não fluorescente, ("Non-Fluorescentre Quenquer") (MGBNF), ligado covalentemente à extremidade 3'. Moldes padrão de oligonucleotídeos foram desenhados pela adição de 10 bp de sequência específica de genes para as extermidades 5' e 3' do amplicon. Iniciadores purificados por HPLC de fase reversa e moldes padrão de oligonucleotídeos foram adquiridos da Biosearch Technologies INC., Novato, CA. Iniciadores purificados por HPLC e sonda para gliceraldeído -3-fosfato desidrogenase (GAPDH) murino foram sintetizados em Biogen Idec [CATGGCCTTCCGTGTTCCTA, GCGGCACGTCAGATCC, 6FAM-CCCCAATGTGTCCGTC].
9. Ciclo térmico Taqman. Reações de PCR em quadriplicata para amostras e padrões foram submetidas a ciclos em um ciclador térmico 7900HT (Applied Biosystems Inc.) sob as seguintes condições: 50°C por 2 minutos (digestão com uracil N-desglicosilase), 95°C, 10 minutos (ativação Taq polimerase termoestável), e 40 ciclos de 95°C por 15 segundos e 60°C por 60 segundos. A emissão de fluorescência foi coletada cada 7 segundos para a duração da corrida para cada cavidade de reação. Quantidades de transcritos relativas foram determinadas para cada amostra por comparação à curva padrão de oligonucleotídeos usando o software Sequence Detection (Applied Biosystems Inc.).
10. Marcação, hibridização e varredura de sonda para caracterização de transcritos. Marcação, hibridização e coloração de amostras foram efetuadas de acordo com o protocolo Preparação de Alvo Eucariótico no Affymetrix Technical Manual (701021 , rev. 1) para Análise de Expressão GeneChip® (Affymetrix, Santa Clara, CA). Em resumo, 5 μg de RNA total purificado foi usado em 20 μΙ_ de reação de primeira filamento com 200 U de SuperScript II (cat3, 18064-022, Invitrogen) e 0,5 μg de iniciador (dT)-T7 [5'- GGCCAGTGAATTGTAATACGACTCACTATAGGGAGGCGG<T)24], a 42°C, por 1 hora. A síntese da segundo filamento foi efetuada pela adição de 40 U de DNA Polimerase de E. coli (cat N- 18010-25, Invitrogen), 2 U de RNase H de E. coli (cat N- 18021 -071 , Invitrogen) e 10 U de DNA Ligase de E. coli (cat N2 18052-019, Invitrogen) seguida por incubação a 16°C, por 2 horas. A reação de síntese do segundo filamento foi purificado usando o Módulo de Limpeza de Amostra GeneChip® de acordo com o protocolo do fabricante (cat N2 900371 , Affymetrix, Santa Clara, CA). cDNA purificado foi amplificado usando kit de marcação de transcrição de RNA, com alto rendimento, BioAr- ray (cat N2 42655-40, Enzo Life Scinces, Inc., Parmingdale, NY) de acordo com o protocolo do fabricante para produzir 7-120 μg de cRNA marcado com biotina (RNA complementar). Conjunto de sondas MgU74Av2, MgU74Bv2, e MgU74Cv2 de camundongo GeneChip® foi pré-hibridizado em uma Forno de Hibridização 640 GeneChip® (Affymetrix, Santa Clara, CA) de acordo com o protocolo do fabricante. cRNA marcado fragmentado foi re-suspenso em 300 μί de tampão de hibridização 1X contendo ácido 2-morfolinometanossul-fônico, [Na+] 1 M, EDTA 20Mm, Tween 20, 0,01 %, 0,5 mg/mL de BSA Aceti-lado, 0,1 mg/mL de DNA de esperma de arenque, oligo de controle B2, e transcritos de controle bioB 1 ,5 pM, bioC 5 pM, bioD 25 pM, e cre 100 pM, e hibridizado para conjuntos de sondas GeneChip® de acordo com o protocolo do fabricante (Affymetrix, Santa Clara, ÇA). Os conjuntos de sondas GeneChip® hibridizados foram lavagens e coloridos usando Estreptavidina-Ficoeritrinina (cat N2 S866, Molecular Probes, Eugene, OR) e amplificados com antiestreptavidina biotinilada (BA-0500, Vector Laboratories, Burlinga-me, CA) usando Fluidics Station 400 GeneChip® (Affymetrix, Santa Clara, CA). Os conjuntos de sondas GeneChip® foram escaneados usando Esca-ner GeneArray (Hewlett Packard, Corvallis, OR).
1. Análise de dados de caracterização de transcritos. Os conjuntos escaneados foram convertidos em arquivos CEL Affymetrix, e o conjunto de dados resultante (grupos de arquivos CEL representando o experimento completo) foi normalizado usando o Método Robusto de Médias de Microarray (RMA). Análises estatísticas e de agrupamento ("clustering") fo- ram feitas usando ferramentas de exploração de dados GeneSpring (Agilent) e Spotfire (Spotfire). Usando uma filtragem ANOVA de duas etapas e variação de expressão para identificar conjuntos de sonda, cuja identidade foi alterada por tratamento experimental em comparação com o grupo Col4A3-/- não tratado em p<0,05 e pelo menos 2 vezes. Similarmente, transcritos associados a doenças foram selecionados quanto à expressão diferencial entre os grupos Col4A3-/-nulos não tratados e as virgens de tipo selvagem usando o valor de coorte estatístico de p,0,02 e o valor de cutoff de variação de expressão de sinal de 2. Os perfis do grupo resultante de genes e o grupo de condições experimentais foram analisados e visualizados por clustering hierárquico. A análise de caminho virtual foi realizada usando a base de dados Ingenuity Pathway Analysis (Ingenuity Systems).
RESULTADOS:
1. Expressão de ανββ em amostras de rim humano com patologia fibrótica. Vários tipos diferentes de doença renal humana, associada à patologia inflamatória/fibrótica, têm mostrado uma expressão aumentada correspondente de TGF-β no tecido de rim25"27. Usando análise imunoistoquímica, examinou-se expressão de Ον β em amostras de biópsia de rim humano associadas à inflamação crónica e fibrose como um mecanismo potencial levando à ativação aumentada de TGF-β (figura 29A e figura 29B). Amostras de tecidos provenientes de glomerulonefrite membranosa, diabetes melito, nefropatia por IgA, síndrome de GoodPasture, Alport, e Lúpus, todos mostraram coloração proeminente de Ονββ na revestimento epitelial de túbulos dilatados e lesionados. Em contraste, as amostras de rins morfologicamente normais (carcinoma renal e tecido normal), mostraram imunocoloração ocasional em túbulos. Coloração glomerular estava ausente em todas as amostras de rim analisadas. Essa constatação é consistente com relatos prévios que Ονββ é expresso em baixos níveis em epitélio adulto saudável, mas é supra-regulado durante a lesão de tecido e reparo10'11'13,15,17.
2. Expressão de θνββ nos rins de camundongos Col4A3-/- está correlacionada com a progressão de fibrose renal. Camundongos Col4A3-/-, um modelo de camundongo de doença de Alport humana, desenvolvem glomerulonefrite progressiva levando ao acúmulo de ECM em ambas as regiões glomerulares e intersticiais do rim acompanhada por aumentada expressão de vários rótulos padrão de fibrose29,29. Foi previamente reportado que o tratamento de camundongos Col4A3-/- com rsTGF^RII-lg leva à inibição de fibrose renal7. Rins de camundongos Col4A3-/- começam a mostrar sinais histológicos de fibrose em aproximadamente 5 a 6 semanas de idade. A doença progride rapidamente com a idade e os camundongos morrem de insuficiência renal em aproximadamente 11 semanas. Camundongos Col4A3+/- heterozigotos não desenvolvem glomerulonefrite e seus rins são histologica- mente indistinguíveis daqueles de animais da mesma ninhada do tipo selvagem. Para examinar a dinâmica da expressão de Ονββ em rins de camundongos Col4A3+/-, e Col4A3-/- (Alport) de idade crescente, realizamos análise imunoistoquímica da expressão de ανββ em rins isolados de camundongo de 4, 7 e 8 semanas de idade (figuras 30A-C). Com quatro semanas de idade, ocorreu expressão ocasional de Ονββ em túbulos de rins de ambos os camundongos Col4A3+/- e Col4A3-/-. Em torno de 7 semanas, a expressão de ανββ foi marcadamente aumentada nas células epiteliais tubulares de camundongos Col4A3-/-, mas não nos rins de Col4A3+/-. Essa expressão aumentada de θνβε foi persistente nos camundongos Col4A3-/- acima de 8 semanas de idade. Também observamos um aumento da intensidade de colo-ração nas células epiteliais dos túbulos dilatados e danificados nos camundongos Col4A3-/- (Alport) de 6 semanas de idade, que foi acompanhada por um aumento significante da área de tecido de rim mostrando forte expressão de ανβ6· A expressão aumentada durante o período de 7-8 semanas de idade coincidiu com rápida progressão da fibrose renal em camundongos Col4A3-/-. Em contraste, somente expressão mínima de Ονβε, e um leve aumento dependente de idade detectável de sua intensidade de imunocolora-ção foram detectados nos rins de camundongos Col4A3+/- por todo o tempo. Já que a expressão de Ον ε em rins de camundongos Col4A37- se correlacionou com a progressão da fibrose,- desejou-se determinar se o bloqueio da função de Ονββ poderia inibir a iniciação e a progressão de lesões fibróticas.
3. Especificidade de ligação de mAbs a Ονββ nos rins de camun- dongos Col4A3-/-. Reportou-se previamente a geração de mAbs anti-Ov 6 potentes e seletivos, incluindo mAbs que se ligam a θνβ6 sem afetar sua capacidade de se ligar a ligantes (mAbs não bloqueadores) e mAbs que bloqueiam tanto a ligação de ligante como a ativação de TGF-β mediada por ανββ (mAbs bloqueadores). Para verificar se mAbs bloqueadores de Ονββ usados para estudos in vivo eram seletivos para ligação à integrina ανββ, efetuou-se análise FACS (figura 31 A) comparando a ligação do θνβ6 mAbs com células NIH3T3 parentes não transfectadas e com as células NIH3TE transfectadas com cDNA de β6 murino (NIH3T3B6). Enquanto um mAb anti-ocv de controle, RMV7, coloriu ambas as células NIH3T3 não transfectadas e expressando ανββ, os mAbs anti-a^6 se ligaram seletivamente somente às células NIH3T3b6. Para confirmar a especificidade de ligação de ο ββ em rins, geramos uma forma quimérica humana/camundongo do αν 6 de bloqueio, 3G9, e comparou-se o padrão de imunocoloração produzido com um anticorpo monoclonal anti-αν de coelho (figuras 31 B e 31 C). A forma murino quimérica e original de 3G9 mostrou afinidades de ligação ao alvo comparáveis conforme determinação por FACS e ELISA (dados não mostrados). A forma quimérica de 3G9 imunocoloriu especificamente células epiteliais tubulares em rins de camundongos Col4A3-/- e não mostraram imunocoloração de seções de rim de camundongos Col4A3-/- cruzados com camundongos β6-/- (ΟοΙ4Α3-/-;β6-/-). Imunocoloração de rins com o anticorpo anti-av não revelou diferenças significantes entre os camundongos Col4A3-/- ou camundongos ΟοΙ4Α3-/-;β6-/-.
4. Tratamento de camundongos Col4A3-/- (Alport) com mAbs βηίι'-θνββ inibe a fibrose renal. Para determinar o envolvimento funcional potencial de ανββ na regulação da fibrose renal, testou-se a habilidade de Ονββ mAbs de bloqueio de afetar a iniciação e progressão dos lesões fibróticas avançadas. Para avaliar os efeitos preventivos de bloqueio de θνβε, camundongos Col4A3-/- foram tratados a partir de 3 semanas a 7 semanas de idade ou a partir de 3 semanas a 8,5 semanas de idade com dois ανββ mAbs de bloqueio diferentes, 3G9 ou 8G6; um ανββ mAb de não bloqueio, 6.8B3, ou um mAb de controle negativo emparelhado com isótipo, 1 E6. Para referência de fenótipo e para monitorar os efeitos de inibição de TGF-β sistémico, esses estudos incluíram também camundongos Col4A3-/- tratados com rsTGFpRII-lg. Rins foram coletados para avaliação histológica e para isolar RNA. As marcas de destaque histológicas de fibrose bem como a expressão de SMA foram dramaticamente aumentadas nos rins Col4A3-/- em 7 e 8,5 semanas em comparação com rins de camundongos Col4A3+/- de idades emparelhadas. Os rins de camundongos Col4A3-/- tratados com mAb de controle negativo apresentaram um mesângio fibrótico glomerular e expandido e uma formação crescente da cápsula de Bowman (figura 32A, 1 E6). Esses rins mostraram também ativação acentuada de miofibroblastos e fibrose intersticial que foi associada à lesão e dilatação epitelial tubular. Tratamento de camundongos Col4A3-/- com ανββ mAbs de bloqueio, 6.3G9 ou 6.8G6, reduziu drasticamente a lesão glomerular e intersticial e fibrose, resultando em conservação de modo geral considerável da arquitetura do rim (figura 32A, 3G9 e 8G6). Esses efeitos dos θνβ6 mAbs de bloqueio foram acompanhados da redução da expressão de SMA por >65% nos glomérulos e por >90% na regiões intersticiais (figuras 32B e 32C). O efeito dos mAbs de bloqueio na expressão de SMA nos glomérulos sugere que enquanto a expressão da integrina θνβ6 está restrita às células epiteliais tubulares, o bloqueio de sua função pode ter efeitos em sítios mais distantes no tecido. O que poderia ser mediado pelo menos em parte devido aos efeitos sistémicos indiretos dos θνβ6 mAbs de bloqueio. Não foi observado nenhum efeito na progressão da fibrose nos rins dos camundongos Col4A3-/- injetados com o θνβ6 mAb de bloqueio, 8B3. Consistente com a inibição previamente reportada de fibrose renal por meio de bloqueio de TGF-β 7|30"33, o tratamento de camundongos Col4A3-/- com ΓεΤβΡβΡΙΙ-^ produziu a inibição da fibrose renal similar àquela produzida por ο ββ mAbs de bloqueio, conforme julgado pelas alterações na aparência histológica e teor de SMA dos tecidos de rim. Os efeitos de mAbs de bloqueio de ανββ na expressão de SMA foram igualados pela redução dos níveis totais no tecido do rim de mRNA no colágeno 1a1 e colágeno 1ot2 (figuras 33A e 33B). O tratamento dos camundongos Col4A3-/- com 3G9, 8G6, ou rsTGF^RII-lg causou uma significante redução da abundância de mRNA no colágeno 1oc1 e colágeno 1 a2, ao passo que o θνββ mAb de não bloqueio e mAb de controle de isótipo não mostraram nenhum efeito significante nos níveis destes transcritos. * '
Para testar o impacto do bloqueio de ανββ na fibrose renal avançada, estudou-se os efeitos de mAbs de bloqueio de ανββ na fibrose renal em camundongos Col4A3-/- com seis semanas de idade, em cujo tempo a patologia do rim é manifestada por lesão e acúmulo mensuráveis de fibro- blastos .ativados positivos para SMA. Os camundongos foram tratados com mAb de bloqueio de ανβε, 3G9, ou com um mAb de contfolè de teótipo, 1 E6, por 2,5 semanas e então sacrificados com 8,5 semanas de idade. A quantificação de imunocoloração de SMA revelou um decréscimo na presença de fibroblastos positivos para SMA nos rins dos camundongos Col4A3V- tratados com 3G9 em comparação com camundongos tratados com mAb de controle de isótipo (figura 34A). De igual importância, a intensidade e área de imunocoloração de SMA com tratamento com 3G9 retardado foram diminuídas em comparação com o nível de SMA observado no início de tratamento (6 semanas). O tratamento retardado dos camundongos Col4A3-/- com 3G9 induziu uma acentuada reversão da patologia, incluindo uma redução significante nos túbulos danificados e fibrose no interstício em comparação com os rins isolados de camundongos Col4A3-/- tratados com 1 E6.
Esses resultados sugerem que o bloqueio terapêutico de θνβ6 não somente inibe a progressão da fibrose renal, como também permite a resolução de lesões fibróticas existentes.
5. Regulação de expressão de gene de rim pelo mAbs anti-c^6. Para obtenção de maior discernimento dos mecanismos da doença associados à função de ανββ. realizamos uma análise Affymetrix GeneChip de expressão de genes em tecidos de rim dos camundongos do tipo selvagem e Alport. Um grupo de genes com expressão alterada nos rins Col4A3-/- foi identificado como 395 conjuntos de sonda GeneChip mostrando pelo menos uma diferença média de 2 vezes em intensidade de sinal normalizado entre rins do tipo selvagem emparelhados em idade com os Col4A3-/- de 7 sema-nas de idade em ρ,Ο,Ο (figura 31). Anotação funcional dos genes expressos diferencialmente foi realizada usando a ferramenta Ingenuity Pathway Analy- sis (IPA) e tem indicado associação predominante de genes superexpressos nos rins Col4A3-/- com funções de leucócitos de inflamação e regulação, ao passo que os genes cuja expressão foi diminuída foram associados primariamente à regulação metabólica (figura 36).
O tratamento dos animais com mAbs de bloqueio de θνββ atenuou a expressão diferencial de um subconjunto de genes èm rins Col4A3-/-. Usamos ã análise de variância (Welch ANOVA) para identificar transcritos afetados pelos tratamentos experimentais em p<0,05 e subsequentemente filtrados os conjuntos de sonda resultantes para selecionar aqueles que mostram pelo menos uma diferença de duas vezes em intensidade de sinal em resposta a um tratamento. Esse procedimento rendeu 56, 42, e 28 conjuntos de sonda afetados significantemente pelos 3G9, 8G6, e TGF RII-Fc, respectivamente. Esses grupos de conjuntos de sonda mostraram uma sobreposição considerável e cada um dos grupos representou um subconjunto inteiramente incluído dos 395 correspondentes aos transcritos diferencialmente expressos em rins Col4A3-/- (figura 37A). Observou-se modulação similar de expressão de gene pelos mAbs de bloqueio de θνβ6 3G9 e 8G6 (figura 35, figura 37 A) previamente mostrada como pertencendo a duas classes bioquímicas diferentes23. Nem o mAb βηίί-ανββ 8B3 de não bloqueio nem o mAb de-controle de isótipo 1 E6 tiveram um efeito significante na expressão gênica. Portanto, o impacto dos ανββ mAbs na expressão gênica do rim era provável devido ao bloqueio da função de Ονββ em vez da ativação da sinalização de integrina ou a eventos não específicos. Não observou-se efeitos significantes do ονβε mAb de bloqueio 3G9 na expressão gênica no tecido de rim do tipo selvagem normal. Essa observação sugeriu que os efeitos de mAbs de bloqueio de θνββ observados nos experimentos refletiram primariamente as funções reguladoras específicas da doença de Ονββ- Para explorar as relações potenciais dos genes modulados por ( νββ mAbs com as principais vias reguladoras, submetemos as listas de genes respectivas à análise em rede reguladora virtual usando- o software IPA (figura. 37). IPA compara as listas dé genes proporcionadas como entrada para um para uma base de dados curada de interações físicas e reguladores conhecidas dentre os genes e proteínas. Essa análise produz uma lista classificada e configurações individuais das vias reguladoras que são mais prováveis de serem refletidas por uma dada lista de genes modulados. Embora as listas de genes modulados por 3G9 e 8G6 não tenham sido completamente idênticas. IPA revelou as redes dependentes de TGF como a redes reguladoras de classificação mais alta afetadas por 3G9 (figura 37A), bem como por 8G6 (figura 37B). Consistente com essa constatação, o clustering hierárquico dos perfis médios da expressão gênica dos grupos experimen-tais tem demonstrado similarmente entre os padrões de modulação de genes por ανβε mAbs e por rsTGF RII-lg (figura 35).
6. Bloqueio de expressão de ο ββ reduz expressão de TGFp nos rins Col4A3-/-. Para determinar se a fibrose renal diminuída, detectada com tratamento com mAb 3G9 e 8g6, estava associada à expressão de TGF-β diminuída, seções de rim foram imunocoloridas com um mAb anti-TGF-βΙ (figura 38A). O mAb que foi usado para imunocoloração foi um que se ligasse preferencialmente às seções de tecido expressando constitutivamente TGF-β ativo versus TGF-β latente (dados não mostrados)24. O tratamento dos camundongos com 3G9 ou com 9G6 causou uma redução significante na imunocoloração de TGF-βΙ em ambas as regiões intersticiais e glomeru-lares dos rins. Essas alterações na expressão de TGF-β foram acompanhadas por alterações análogas nos níveis totais no tecido do rim de mRNA de TGF-β (figura 38B). O padrão de imunocoloração de TGF-β† indicou que embora a expressão de ανβε estivesse restrita ao revestimento epitelial dos túbulos do rim, a inibição da função de θνββ poderia levar à expressão diminuída de TGF-β em sítios distais tais como as regiões glomerulares, que não são imediatamente adjacentes às áreas de expressão de θνββ- Isso pode sugerir que embora Ονββ possa servir como um desencadeador inicial da ativação local de TGF-β, ele poderia produzir também efeitos reguladores de longa extensão no TGF-β. Um possível mecanismo de tais efeitos de longa extensão poderia ser baseado na capacidade de TGF-β de ativar sua própria expressão em um modo autócrino ou parácrino levando à expansão das á- reas de tecido que expressam TGF-β. Também se inclui a possibilidade de uma inibição local inicial de ativação de TGF-β por bloqueio de θνβε interferir com o processo de inflamação e fibrose, que poderia então diretamente in-framodular a atividade de TGF-β.
7. Ablação Genética do gene de β6 nos camundongos Col4A3-/-.

Para validar as constatações dos experimentos com mAb, produziu-sé camundongos nocaute ("Knockout mice"), duplo, Col4A3 e β6 (ΟοΙ4Α3-/-;β6-/-). Exame histológico dos rins de camundongos ΟοΙ4Α3-/-;β6+/-, e ΟοΙ4Α3-/-;β6-/- com idade emparelhada confirmaou os resultados obtidos em estudos com mAbs de bloqueio de ανββ· Houve uma significante redução da imunocolora-ção de SMA de rins provenientes de camundongos ΟοΙ4Α3-/-;β6-/- de 7 a 10 semanas de idade em comparação com camundongos ΟοΙ4Α3-/-;β6+/- com idade emparelhada (dados não mostrados). Isto foi acompanhado por um drástico decréscimo na fibrose nas regiões glomerulares e intersticiais dos rins (figura 39). Isso é demonstrado por uma redução da expressão de colá-geno e uma arquitetura bem conservada dos rins como observado em rins coloridos com tricromo-de Masson de ΟοΙ4Α3-/-;β6-/- de 10 semanas de idade em comparação com rins de idade emparelhada provenientes de camundongos ΟοΙ4Α3-/-;β6+/-. A consistência dos efeitos antifibroticos observados com tratamento com Ονββ mAbs de bloqueio em comparação com a ablação genética da função de β6 indica que o tratamento com mAb é uma abordagem eficaz para bloquear a função de θνββ in vivo.
7. Resposta à dose de inibição por 3G9 de fibrose renal em camundongos Col4A3-/-. Os camundongos Col4A3-/- foram tratados 3 x por semana com concentrações crescentes de 3G9. Os camundongos foram tratados a partir de 3 semanas de idade a 7 semanas de idade e então sacrificados. Análise imunoistoquímica de SMA foi analisada tanto no córtice como nas regiões medulares do rim. A titulação da dose demonstrou que 3G9 inibiu a expressão de SMA com uma ED50 de 0,3 a 0,4 mg/kg nos camun-dongos Col4A3-/- (figura 40).
DISCUSSÃO:
A progressão da doença renal é acompanhada por intensa re- modelação, inflamação e formação de tecidos das lesões fibróticas levando por fim à ruptura da arquitetura do tecido do rim e à perda da função renal. A fibrose é central para esse processo e envolve a ativação e expressão de fibroblastos, neovascualrização do tecido doente, e deposição massiva da matriz extracelular. Os mecanismos moleculares implicados como principais acionadores desses eventos incluem a regulação errónea do eixo do TGF-β por expressão alterada das proteínas ECM e seus receptores nas células que populam as lesões fibrótica25"27, e a importância funcional do TGF-β na promoção da fibrose tecidual tem sido documentada in vitro e em modelos de animal de doença. A superexpressão de TGF-β é suficiente para induzir a ativação de fibroblastos e angiogênese in vivo e para ativar a produção excessiva de ECM em culturas organotípicas e de celulares34,37,38. Inversamente, ruptura genética ou famracalógica de sinalização de TGF-β proporciona proteção eficaz contra fibrose em modelos de fibrose pulmonar, dérmica e renal30,32,33,39"41.
Vários estudos direcionados à inibição sistémica da função de TGF-β (mAbs de bloqueio, rsTGF^RII-lg, inibidores de receptor de TGF-β quinase) têm mostrado que atenuam a fibrose em modelos animais de doença. Contudo, todas essas abordagens tiveram como objetivo bloquear a forma ativada de TGF-β, enquanto o potencial terapêutico dos agentes que bloqueiam a ativação de TGF-β permanece menos explorado. TGF-β é expresso como um precursor latente e pode ser convertido em uma citocina biologicamente ativa por vários mecanismos que incluem espécies de oxigénio reativo, pH, trombospondina-1 , proteinases extracelulares, e integri-nas2 ,42-44. De particular interesse dentre os últimos está θνβ6, uma integrina induzível por TGF-β expressa nos sítios de remodelação epitelial e que mostra que funciona como receptor e ativador do TGF-β latente11 ,17,45. A subuni-dade β6 é supra-regulada em várias formas da doença renal10, e sua ablação genética mostrou que proporciona acentuada proteção contra fibrose renal induzida por lesão no modelo de camundongo de obstrução ureteral unilateral (UUO)46. Proteção similar de camundongos deficientes de β6 tem sido observada no modelo de fibrose pulmonar por bleòmicina sugerindo que ανββ pode mediar fibrose em tecidos diversos17,47. Interessantemente, fosfori- lação induzida por UUO de SMAD2, um mediador central de sinalizador de TGF-β, foi acentuadamente reduzida nos rins deficientes de β6, indicando que Ονββ pode certamente operar in vivo como parte do circuito regulador de TGF-β.
Estudos prévios com camundongos de nocaute β6 têm proporcionado evidência que Ονβε pode desempenhar um papel na iniciação da fibrose, sugerindo essa integrina como um novo alvo terapêutico. Procurou-se determinar se inibição farmacológica da função de ο ββ com mAbs de bloqueio poderia atenuar a fibrose renal em camundongos Col4A3-/-, um modelo de animal da síndrome de Alport, recessiva autossômica28'29. A síndrome de Alport é uma doença hereditária causada por mutações nos genes Col4A3, Col4A4, ou Col4A548. Defeitos nesses genes resultam na montagem aberrante de redes de colágeno IV e formação anormal das membranas glomerulares e basais tubulares. Pacientes com Alport desenvolvem glome-rulonefrite progressiva que leva à doença renal de estágio final. Observou-se supra-regulação acentuada de ανββ em Alport humana, bem como em tecidos de rim de camundongos Col4A3-/-. Nò rim de camundongo Col4A3-/-, a expressão aumentada de ο ββ era particularmente proeminente no epitélio tubular, onde precedeu e acompanhou a expansão ampla de células positivas para SMA e deposição de colágeno. Com base nesse padrão de expressão, formulou-se a hipótese que ανββ se torna supra-regulado cedo no ciclo de resposta epitelial à lesão e pode ser um importante mediador tanto na iniciação como na manutenção da fibrose em uma situação de dano epitelial persistente. Os resultados de nossos estudos mostram bloqueio mediado por anticorpo de ανββ pode tanto inibir a iniciação, bem como a progressão precoce da fibrose renal e suprimir sua manutenção. Consistente com os achados anteriores do modelo de camundongo deficiente de β6 de UU-O46, os efeitos de mAbs de bloqueio de ανββ observados nos experimentos se correlacionaram com a atividade e expressão reduzidas de TGF-β. Interessantemente, o aparente decréscimo de TGF-β e de expressão de SMA seguintes ao tratamento com νββ mAbs ocorreu somente na vizinhança i- 5

mediata das células positivas para θνββ, mas foi também detectável em regiões teciduais relativamente distais. Embora essa constatação possa sugerir que Ονββ pode contribuir com a ativação do eixo do TGF-β, tanto de um modo direto como de um modo indireto, por exemplo, por meio de auto-ativação parácrina da expressão de TGF-β, não se exclui a possibilidade de que o bloqueio de ανββ possa proporcionar proteção através de efeitos extra- renais, inclusive alteração da função imune sistémica. Avaliou-se níveis no soro de várias quimiocinas e citocinas e populações no sangue periférico em camundongos depois de quatro semanas de tratamento com Ονβε mAbs e nenhuma alteração significante foi encontrada. Adicionalmente, somente alterações mínimas em monócitos nos rins de rins Col4A3-/- foram detectadas por imunoistoquímica com tratamento com ανββ mAbs ou nocaute genético do gene de β6. Estudos posteriores avaliando o estado funcional do sistema imune com tratamento com ανββ mAbs ou com estudos de transplante poderiam focar isto mais completamente.
A regulação errónea e a hiperatividade da por meio de de TGF-β têm sido implicadas como um proeminente mecanismo envolvido na pro- . gressão da doença renal nos camundongos Col4A36. Uma característica interessante do circuito de TGF-β que poderia explicar o papel aparentemente dominante desta citocina na doença fibrotica é a capacidade do TGF-β de induzir sua própria expressão. Isso faz surgir a possibilidade que o efeitos antifibróticos de bloqueio de θνβ6 podem ser mediados, pelo menos em parte, por mecanismos indiretos. Isso poderia incluir efeitos a jusante na expressão de TGF-β por alteração da inflamação e fibrose localmente e interferindo com a subsequente atividade do TGF-β. Já que νβε pode ser induzida por TGF-β e promover a ativação de TGF-β latente, explorou-se a relação funcional entre TGF-β e Ονββ mediando a patologia de rim Col4A3-/-. Compa-rou-se os impactos de νβ6 mAbs e rsTGF^RII-lg na expressão de transcritos associados à doença nos rins de camundongos Col4A3-/-. Essa comparação revelou uma associação funcional distinta dos genes dependentes de Ονβε com TGF-β bem como uma similaridade bem-próxima dos padrões de modulação de genes por θνββ mAbs e por rsTGF^RII-lg. Além disso, o tra- tamento de camundongos Col4A3-/- com mAbs de bloqueio de ανββ inibiu a expressão no rim de TGF-β. Essas constatações mostram que os efeitos modificadores da doença de ανββ mAbs poderiam resultar da inibição da função de TGF-β, possivelmente por meio de supressão da ativação mediada por ο β6 do TGF-β latente no tecido doente. Um aspecto intrigante dos dados acima é a inibição da expressão de gene pró-inflamatório através do bloqueio de ονβθ ou TGF-β. TGF-β tem funções antiinflmatórias e imunossu- pressivas bem estabelecidas, contudo, os padrões de modulação de gene por rsTGF^RII-lg e por mAbs anti-o^6 nesses experimentos foram indicativos de uma função pró-inflamatória de TGF-β no modelo de doença Alport. Embora o mecanismo real desse efeito pró-inflamatório necessite de posterior investigação, ele poderia ser baseado na capacidade conhecida do TGF-β de induzir arresto de crescimento e morte de células epiteliais31 ,49*51. Já que o dano epitelial proporciona um importante mecanismo para ativação de imunorrespostas à lesão tecidual, a aparente função pró-inflamatória de TGF-β sugerida por esses dados poderia ser indireta e mediada por lesão promovida por TGF-β ao epitélio do rim. De acordo com esse modelo, ανββ pode funcionar como um importante componente do mecanismo dependente de TGF-β da remodelação epitelial, e a regulação errónea de sua função na doença poderia ainda promover lesão e inflamação no tecido associado à doença.
Os resultados desse estudo demonstram que Ονββ é altamente supra-regulada em doença de rim humano e ao direcionar ο ββ com anticorpos de bloqueio de função pode fornecer uma nova e eficaz abordagem para modulação terapêutica da fibrose renal. Já que a expressão de θνβ6 é altamente restrita às células epiteliais no tecido doente, essa abordagem permite a supressão local de função de TGF-β. Como TGF-β é expresso em uma variedade de células e tipos de tecido, e desempenha um importante papel na regulação de vários processos homoestáticos diferentes, o bloqueio da função de θνβ6 oferece uma alternativa mais segura para a inibição sistémica de TGF-β naquelas doenças onde a integrina θνβ6 é supra-regulada.

CONCLUSÕES
Ονββ é superexpressa em doença renal humana associada à patologia inflamatória e fibrótica.
mAbs de bloqueio de ανββ inibem a fibrose em modelo Col4A3-/- (Alport) de fibrose renal.
Estudos de tratamento retardado indicam que o bloqueio terapêutico de θνβ6 não somente inibe a progressão da fibrose renal, mas também permite a resolução de lesões fibróticas existentes.
Nocaute genético de β6 leva à proteção nos camundongos

Co]4A3-/-.
A caracterização de transcritos mostrou que mAbs de bloqueio de ανββ inibiram significantemente alterações associadas a doenças na expressão de mediadores fibróticos e inflamatórios.
Padrões similares de modulação de transcritos foram produzidos com tratamento com TGF-β Rll solúvel sugerindo funções reguladoras compartilhadas de θνββ e TGF-β.
REFERÊNCIAS:
1. Okada H, Kalluri R: Cellular and molecular pathways that lead to progres-sion and regression of renal fibrogenesis. Curr Mol Med 2005, 5:467-474

2. Sheppard D: Functions of pulmonary epithelial integrins: from development to disease. Physiol Rev 2003, 83:673-686 - 3. Norman JT, Fine LG: Progressive renal disease: fibroblasts, extracellular matrix, and integrins. Exp Nephrol 1999, 7:167-177
4. Border WA, Noble NA: Jnteractions of transforming growth factor-beta and angiotensin II in renal fibrosis. Hypertensíon 1998, 31 :181-188
5. Wang W, Koka V, Lan HY: Transforming growth factor-beta and Smad signalling in kidney diseases. Nephrology 2005, 10:48-56
6. Sampson NS, Ryan ST, Enke DA, Cosgrove D, Koteliansky V, Gotwals P: Global Gene Expression Analysis Reveals a Role for the alpha 1 Integrin in Renal Pathogenesis. J Biol Chem 2001 , 276:34182- 34188
7. Cosgrove D, Rodgers K, Meehan D, Miller C, Bovard K, Gilroy A, Gardner H, Kotelianski V, Gotwals P, Amattucci A, Kalluri R: Integrin αΙβΙ and trans- forming growth factor-βΙ play distinct roles in alport glomerular pathogenesis and serve as dual targets for metabolic therapy. Amer J of Pathol 2000, 157:1649-1659
8. Hamerski DA, Santoro SA: Integrins and the kidney: biology and pathobio- logy. Curr Opin Nephrol Hypertens 1999, 8:9-14
9. Zambruno G, Marchisio PC, Marconi A, Vaschieri C, Melchiori A, Giannetti A, De Luca M: Transforming growth factor-βΙ modulates βΙ and β5 integrin receptors and induces the de novo expression of the avfi6 heterodimer in normal human keratinocytes: implications for wound healing. J Celi Biol 1995, 129:853-865
10. Trevillian P, Paul H, Millar E, Hibberd A, Agrez MV: alpha(v)beta(6) Integrin expression in diseased and transplanted kidneys. Kidney Int 2004, 66:1423-1433
11. Breuss JM, Gallo J, DeLisser HM, Klimanskaya rV, Folkesson HG5 Pittet JF, Nishimura S, Aldape K, Landers DV, Carpenter W, Gillett N, Sheppard D, Matthay MA, Albelda SM, Kramer RH, Pytella R: Expression of the B6 subu-nit in development, neoplasia and tissue repair suggests a role in epithelial remodeling. J Celi Sei 1995, 108:2241-2251
12. Breuss JM5 Gillett N, Lu L5 Sheppard D5 Pytella R: Restricted distribution of integrin B6 niRNA in primate epithelial tissues. J Histochem and Cytochem 1993, 41 :1521 -1527 - 13. Hakkinen L, Hildebrand HC5 Berndt A5 Kosmehl H, Larjava H: Imrnuno localization of tenascin-C, a9 integrin subunit, and avB6 integrin during wound healing in human oral mucosa. J of Histochem and Cytochem 2000, 48:985-998
14. Arend LJ, Smart AM, Briggs JP: Mouse β6 integrin sequence, pattern of expression, and role in kidney development. J Amer Soe Nephrol 2000, 11.2297-2305
15. Hakkinen L, Koivisto L Gardner H, Saarialho-Kere U, Carroll JM, Lakso M, Rauvala H, Laato M, Heino J, Larjava H: Increased expression of B6-integrin in skin leads to spontaneous development of chronic wounds. Am J Pathol 2004, 164:229-242 16. Huang XZ, J. W, Spong S, Sheppard D: The integrin avB6 is criticai for keratinocyte migration on both its known ligand, fibronectin, and on vitronec- tin. J Celi Sei 1998, 111 :2189-2195
17. Munger JS, Huang X, Kawakatsu H, Griffiths MJD, Dalton SL, Wu J, Pittet JF, Kaminski N, Garat C5 Matthay MA, Rifkin DB, Sheppard D: The integrin avB6 binds and activates latent TGFBI: a mechanism for regulating pulmo- nary inflammation and fibrosis. Celi 1999, 96:319-328.
18. Yokosaki Y, Monis H, Chen A, Sheppard D:
Differential effeets of the integrins alpha9betal, alphavbeta3, and alphavbeta6 on cell proliferative responses to tenascin. Roles of the beta su- bunit extracellular and cytoplasmic domains. J Biol Chem 1996, 271 :24144-24150
19. Annes JP, Rifkin DB, Munger JS: The integrin avB6 binds and activates latent TGFB3. FEBS lett 2002, 511 :65-68
20. Munger JS, Harpel JG, Gleizes PE, Mazzieri R, Nunes I, Rifkin DB: Latent transforming growth factor-β: structural feature and mechanisms of activation. Kid Int 1997, 51 :1376-1382
21. Khalil N: TGF-beta: from latent to active. Microbes Infect 1999, 1 :1255-1263
22. Barcellos-Hoff MH: Latency and activation in the control of TGF-β. J Mamm Gland Biol 1996, 1 :353-363
23. Weinreb PH, Simon KJ, Rayhorn P, Yang WJ, Leone DR, Dolinski BM, Pearse BR, Yokota Y, Kawakatsu H, Atakilit A, Sheppard D, Violerte SM: Function-blocking integrin alphavbeta6 monoclonal antibodies. J Biol Chem 2004, 279:17875-17887
24. Barcellos-Hoff MH, Ehrhart EJ, Kalia M, Jirtle r, Flanders KC, Tsang ML-S: Immunohistochemical detection of active transforming growth factor-β in situ using engineered tissue. Amer J of Pathol 1995, 147:1228-1237
25. Yamamoto T, Nakamura T, Noble NA, Ruoslahti E, Border WA: Expres-sion of transforming growth factor beta is elevated in human and experimental diabetic nephropathy. Proc Natl Acad Sei, USA 1993, 90:1814-1818

26. Yamamoto T, Noble NA, Cohen AH, Nast CC, Hishida A, I. GL, Border WA: Expression of transforming growth factor-beta isoforms in human glomerular diseases. Kidney Int 1996, 49:461 -469
27. Shihab FS, Yamamoto T, Nast CC, H. CA, Noble NA, Gold LI, Border WA: Transforming growth factor-beta and matrix protein expression in acute and Chronic rejection of human renal allografts. J Am Soe Nephrol 1995, 6:286-294
28. Cosgrove D, Meehan D, Grunkemeyer JA, Kornak JM, Sayers R, Hunter WJ, Samuelson GC: Collagen COL4A3 knockout: a mouse model for auto-somal Alport syndrome. Genes Dev 1996, 10:2981 -2992
29. Miner JH5 Sanes JR: Molecular and functional defects in kidneys of mice lacking collagen a3(IV): implications for alport syndrome. J Celi Biol 1996, 135:1403-1413
30. Sharma K, Jin Y, Guo J, Ziyadeh FN:
Neutralization of TGF-beta by an anti-TGF-beta antibody attenu-ates kidney hypertrophy and the enhanced' extracellular matrix gene ex-presssion in STZ- induced diabetic mice. Diabetes 1996, 45:522-530
31. Miyajima A, Chen J, Lawrence C Ledbetter S, Soslow RA, Stern J, Jha S, Pigato J, Lerner ML, Poppas DESVIO PADRÃO, Darracott Vaughan Jr. E5 Felson D: Antibody to transforming growth factor-β ameliorates tubular apop-tosis in unilateral ureteral obstruction. Kid Int 2000, 58:2310-2313
32. Ziyadeh FN, Hoffman BB, Han DC, lglesias-de la Cruz MC, Hong SW, Isono M, Chen S, McGowan TA, Sharma K: Long- term prevention of renal insufficiency, excess matrix gene expression, and glomerular mesangial matrix expansion by treatment with monoclonal antitransforming growth factor-β antibody in db/db diabetic mice. Proc Natl Acad Sei, USA 2000, 97:8015-8020
33. Kasugá H, Ito Y, Sakamoto S, Kawachi H, Shimizu F, Yuzawa Y, S. M: Effects of anti-TGF-β type II receptor antibody on experimental glomerulone-phritis. Kid Int 2001 , 60:1745-1755
34. Roberts AB, Sporn MB: Regulation of endothelial cell growth, architectu-re, and matrix synthesis by TGF-beta. Am Rev Respir Dis 1989, 140:1126-1128 35. Eickelberg O, Kohler E, Reichenberger F, Bertschin S, Woodtli T, Erne P, Perruchoud AP, Roth M: Extracellular matrix deposition by primary human lung fibroblasts in response to TGF-betal and TGF-beta3. Am J Physiol 1999, 276:L814-L824
36. Varga J, Rosenbloom J, Jimenez SA: Transforming growth factor beta (TGF beta) causes a persístent increase in steady-state amounts of type I and type III collagen and fibronectin mRNAs in normal human dermal fibroblasts. Biochem J 1987, 247:597-604
37. Konig A, Bruckner-Tuderman L: Transforming growth factor-beta promo-tes deposition of collagen VII in a modified organotypic skin modél. Lab Invest i 994, 70:203-209
38. Sirrie PJ, Xing Z, Graham FL, Csaky KG, Gauldie J: Adenovector-mediated gene transfer of active transforming growth factor-βΙ induces pro-longed severe fibrosis in rat lung. J clin Invest 1997, 100:768-776
39. Laping NJ: ALK5 Inhibition in renal disease.
Curr Opin Pharmacol 2003, 3:204-208
40. Bonniaud P, Kolb M, Gait T, Robertson J, Robbins C, Stampfli M, Lavery C, Margetts PJ, Roberts AB, Gauldie J: Smad3 null mice develop airspace enlargement and are resistant to TGF-beta- mediated pulmonary fibrosis. J Immunol 2004, 173:2099-2108
41. Inazaki K, Kanamaru Y, Kojima Y, Sueyoshi N, Okumura K, Kaneko K, Yamashiro Y, Ogawa H, Nakao A: Smad3 deficiency attenuates renal fibrosis, inflammation.and apoptosis after unilateral ureteral obstruction. Kidney Int 2004, 66:597-604
42. Murphy-Ullrich JE, Poczatek M: Activation of latent TGF-beta by throm-bospondin-1 mechanisms and physiology. Cytokine Growth Factor Rev 2000, 11 : 59-69
43. Annes JP, Munger JS, Rifkin DB: Making sense of latent TGFB activation. J Celi Sei 2003, 1 16:217-224
44. Sheppard D: Integrin-mediated activation of latent transforming growth factor beta. Câncer Metastasis Rev 2005, 24:395- 402
45. Sheppard D: Integrin-Mediated Activation of Transforming Growth Factor- {beta} 1 in Pulmonary Fibrosis, chest 2001 , 120:49S-53
46. Ma LJ, Yang H, Gaspert A, Carlesso G, Barty MM, Davidson JM, Sheppard D, Fogo AB: Transforming growth factor-β- dependent and independent pathways of induction of tubulointerstitial fibrosis in B6-/- mice. Am J Pathol 2003, 163:1261 -1273
47. Kaminiski N, Allard JD, Pittet JF, Fengrong Griffiths MJD, Morris D, X. H, Sheppard D, Heller RA: Global analysis of gene expression in pulmonary fibrosis reveals distinct programs regulating lung inflammation and fibrosis. Proc Natl Acad Sei, USA 2000, 97:1778-1783
48. Torra R5 Tazon-Vega B, Ars E, Ballarin J: Collagen type IV ({alpha}3-{alpha}4) nephropathy: from isolated haematuria to renal failure. Nephrol Dial Transplant 2004, 19:2429-2432
49. Bottinger EP, Bitzer M: TGF-beta signaling in renal disease. J Am Soc Nephrol 2002, 13:2600-2610
50. Goumenos DS, Tsamandas AC, El Nahas AM, Thomas G, Tsakas S, Sotsiou F, Bonikos DS, Vlachojannis JG: Apoptosis and myofibroblast expression in human glomerular disease: a possible link with transforming growth factor-beta-1. Nephron 2002, 92:287-296
51. Dai C, Yang J, Liu Y: Transforming growth factor-betal potentiates renal tubular epithelial cell death by a mechanism independent of Smad signaling. J Biol Chem 2003, 278:12537-12545
EXEMPLO 14: Eficácia do 3G9 murino (mu3G) em Modelo de Obstrução

Ureteral de Fibrose Renal
SUMÁRIO
Obstrução Ureteral Unilateral (UUO) é um bem estabelecido modelo de animal de lesão renal levando à fibrose tubulointersticial renal acelerada. Obstrução do trato urinário produz pressão intraluminal aumentada no uréter e túbulos renais que causa lesão parenquimatosa renal. UUO é caracterizada por hidronefrose, dilatação tubular, apoptose tubular renal, atrofia renal progressiva, infiltração celular intersticial, um aumento do TGF-β renal e fibrose intersticial renal1. A função da integrina ανββ pode participar tanto da ativação de TGF-β como do processo de transformação epitelial para mesenquimal. Já que estes processos contribuem para a progressão da doença, o modelo de UUO foi usado para avaliar a eficácia do anticorpo monoclonal anti-o^ mu3G9 e proteína de fusão de Ig tipo II de receptor de TGF-β murino, solúvel, recombinante (rsTGF^rii-lg) contra fibrose renal ra- pidamente progressiva. A inibição percentual média da coloração de actina na musculatura lisa com mu3G9 em 4 mg/kg, dosada i.p. três vezes por semana durante os dez dias do curso do experimento, foi de 32%.
INTRODUÇÃO
Fibrose progressiva é um processo comum que leva ao desen-volvimento de doença renal de estágio final e promovida .por remodelação epitelial, ativação de fibroblastos, inflamação, e reorganização das intera-ções celulares com a matriz extracelular (ECM). Mecanismos moleculares que contribuem com esses eventos são complexos e incluem a regulação errónea do eixo de TGF-β, remodelação de ECM aberrante, e expressão alterada e função de receptores de adesão celular da superfamília de integrinas2"9. Estudos recentes têm revelado funções reguladoras importantes de várias integrinas e moléculas associadas em células epiteliais renais e mesenquimais8,10"13.
Dentre as integrinas cuja expressão é fortemente aumentada na doença renal está a integrina Ονββ induzida por TGF-β3,14,15. A expressão de θνβ6 é geralmente restrita às células epiteliais onde ela é expressa em baixos níveis em tecidos adultos normais e elevados durante o desenvolvimento, lesão, e neoplasia14,16"18. Embora θνβε seja expressa relativamente em níveis baixos em rim adulto saudável, sua expressão é proeminente no de-senvolvimento de rim de camundongos, particularmente nos túbulos proxi-mais, alça de Henle, e dutos coletores16'17,19. Recentemente, expressão elevada de θνββ foi reportada para várias formas de patologia renal humana.
Consistente com a expressão aumentada de ανββ in vivo durante a remodelação de tecido, expressão da integrina Ονββ enn células epiteliais cultivadas pode ser induzida por citocinas que regulam a remodelação epitelial, incluindo EGF e TGF-β3,14. Além disso, superexpressão de β6 na pele de camundongos transgênicos tem mostrado provocar a formação de ferimen- tos crónicos espontâneos sugerindo que ο ββ pode desempenhar um importante papel na regulação de remodelação de tecido epitelial.
Ligantes conhecidos para ανββ incluem fibronectina, tenascina, e os peptídeos 1 e 3 associados à latência (LAP1 e LAP3), os fragmentos N- terminal das formas precursoras latentes de TGF-βΙ e -β321"25. Como resultado da ligação a esses ligantes, Ονβε pode mediar adesão celular, disseminação, migração, e ativação de TGF-β latente. TGF-β e sintetizado como uma proteína latente que é clivada e secretada com o LAP N-terminal não-covalentemente associado à citocina de TGF-β C-terminal, ativa, madura. O complexo de TGF-β latente não pode se. ligar a seu receptor cognato e assim permanece biologicamente inativo até ser convertido na forma nativa por um de vários mecanismos alternativos que incluem clivagem por proteases, exposição a pH baixo ou radiação ionizante, e alterações conformacionais no complexo latente permitindo que ele se ligue aos seus receptores cognatos26"29. Uma alteração conformacional ativadora pode ser induzida por ανββ envolvendo a ligação direta da integrina a um motivo de RGD contido dentro do LAP1 e LAP3. Essa ligação converte o precursor de TGF-β em um estado competente por ligação de receptor22,25. Essas constatações sugerem que a supra-regulação da expressão de ανββ na superfície das células epiteliais pode levar à ativação local de TGF-β, seguida por ativação parácrina de e-ventos dependentes de TGF-β em células "bystander".
Já que TGF-β foi implicado como um regulador central de fibrose renal, foi formujada a hipótese que sua ativação local por ανβε pode ser um processo importante no início e progressão de doença renal e bloqueio da função de ανββ poderia suprimir o desenvolvimento de fibrose renal. Nos estudos descritos aqui foi mostrado que Ονββ é significantemente supra-regulada no modelo de obstrução ureteral unilateral de camundongo de fibrose renal. Foi mostrado que mAbs bloqueando a ligação de ligante e as funções de ativação de TGF-β de Ονββ30 inibem a fibrose no modelo.
Materiais e Métodos
1. Animais. Camundongos C57BL (Jackson Laboratories, Bar Harbor, ME) isentos de antígeno virai, de 8-12 semanas de idades, machos, pesando 25,5 ± 0,2g foram usados nos estudos. Os animais foram alojados na instalação para animais do laboratório isento de vírus, Biogen Idec, em prateleiras com gaiolas isoladoras, ventiladas, e deixados se acomodarem por sete dias antes do início do estudo. Os camundongos tiveram acesso a vontade à ração de camundongo, padrão, irradiada (LabDiet Prolab® 5P75 Isopro® RMH 3000) e água estéril durante toda a acomodação, e período experimental. Peso corporal foi medido em intervalos como parte do monito- ramente da saúde dos animais.
2. Anticorpos e reagentes. ανββ mAbs foram gerados conforme descrição aqui e como previamente descrito30. cDNAs de 2A1 e de 3G9 quiméricos humanos/camundongo foram gerados dos RNAs totais de hibri-domas parentes respectivos com iniciadores de região constante CDL-739 para a cadeia pesada e CDL-738 para a cadeia leve usando o kit de síntese de cDNA do Primeiro filamento (Amersham/Pharmacia, Piscataway, NJ). Os genes de região variável de cadeias pesada e leve foram amplificados pela reação em cadeia de polimerase usando os mesmos iniciadores 3' para a síntese de cDNA e grupos de iniciadores degenerados específicos para a maioria das sequências de sinais de genes de anticorpos murinos (sequências disponíveis mediante solicitação) e Pfu DNA polimerase (Stratagene, La Jolla CA). Regiões variáveis de cadeias pesada e leve clonadas foram ligadas a vetores de expressão de mamífero com regiões constantes de lgG1 humano. Proteína de fusão de Ig tipo II de receptor de TGF-β, murino, estável (sTGFbRII-lg) foi gerada conforme descrição prévia11 e adquirida da R&D Systems (532-R2, Minneapolis, MN).
3. Imunoistoquímica. Seções de tecido foram desparafinizadas em xileno e etanol, re-hidratadas em água destilada, e, então, imersas em metanol contendo 0,45% de H2O. Os tecidos foram incubados com pepsina (00-3009, Zymed, San Francisco, CA) e bloqueados com avidina e biotina (SP-2001 ; Vector Laboratories, Burlingame, CA). O anticorpo primário foi diluído em PBS contendo 0,1% de BSA e os tecidos foram incubados durante a noite, a 4°C. Para imunocoloração de β6 no tecido de camundongo, as seções foram incubadas com uma forma quimérica humana/camundongo do mAb anti- Ονββ, 2Α1 , e um anticorpo secundário biotinilado antihumanp (PK-6103, Vector Laboratories, Burlingame, CA). Para imunocoloração de β6 em tecido murino 2A130, e um anticorpo secundário biotinilado anticamundongo (PK- 6102, Vector Laboratories). Complexo de avidina-biotina-raiz forte peroxia- dase (Vector Kit, PK-6102) foi aplicado às seções, incubadas por 30 minutos à temperatura ambiente, e substrato de 3,3'-diaminobenzindina (DAB) foi preparado conforme instruções (SK-4100, Vector Laboratories) e aplicado às seções por 5 minutos à temperatura ambiente. As seções de tecido foram coloridas com Hematoxilina de Mayer, por 1 minuto, e rinsadas em água e PBS.
4. Indução de obstrução- ureteral unilateral de fibrose renal. Cirurgia para os estudos foi realizada durante o período de dois dias e esquemas de dosagem para os camundongos foram sincronizados com relação ao dia da ligação do uréter. O uréter esquerdo foi assepticamente isolado por meio de uma laparotomia a esquerda da linha média sob anestesia de ceta-mina:xilazina (1.000:10 mg/kg, s.c). Duas ligaduras de seda, apertadas, 6-0, oclusivas, foram colocadas sobre o uréter no nível do pólo inferior do rim, e o coorte do uréter entre as ligaduras. A parede abdominal foi fechada com uma sutura de Vicryl 4-0 e a pele fechada com náilon 4-0. Os animais foram deixados para recuperação em um chumaço com aquecimento e administrados com 0,05 mg/kg s.c. de buprenorfina, duas vezes ao dia, nos Dias 0 e 1. O animais foram dosados três vezes, semanalmente,- com mu3G9 ou duas vezes, semanalmente, com rsTGF- RII-lg, começando no dia antes da cirurgia. O procedimento foi adaptado do relatório previamente descrito31.
5. Coleta de amostras de tecido e análise histológica para indicadores de doença. Os animais foram eutanizados com dióxido de carbono no Dia 10 depois da ligação. Ambos os rins (esquerdo ligado, direito não ligado) foram removidos e repartidos igualmente de forma transversal através do centro da pelve renal. Uma metade de cada rim foi passada em formalina tamponada neutra a 10% para coloração de tecido fixado. A outra metade de cada rim foi colocada em sacarose a 15%, seguida por sacarose a 30% para coloração imunoistoquímica da actina da musculatura lisa.
As seções de rim fixadas em formalina foram coloridas para teor de colágeno com corante de tricromo de Masson, e para anatomia estrutural com H&E. As seções coloridas com tricromo foram morfometricamente quantificadas em imagens capturadas por microscópio de campo claro usando um sistema de análise de imagens Leica Qwin. As imagens foram capturadas usando condições de iluminação padronizadas e ajustes de exposição de câmera digital, corrigidos para fundo, e calibrados para padrões de distância.
Os limites foram estabelecidos para detectar azul escuro para coloração de colágeno em lâminas coloridas com tricromo de Masson. A á- rea de colágeno foi analisada em imagens tomadas em 200X. Imagens de campos contíguos cobrindo a seção de rim esquerdo inteiro foram tiradas de cada animal para quantificação.
6. Análise estatística. O teor de colágeno em cada campo medido foi expresso com o percentual da área de tecido total dentro do campo de 200 X (excluindo qualquer espaço branco), isto é % de área azul. Dezesseis a trinta e cinco campos individuais foram medidos de cada rim. Esses incluíram todo o tecido cortical e medular da seção e excluiu a papila renal. A área média azul em porcentagem de todos os campos no rim ligado esquerdo foi calculada de cada animal e servida como a classificação de fibrose dos animais para teste estatístico. A significância estatística de diferenças relacionadas a tratamento na % de área azul, dentro os vários grupos de tratamento, foi determinada por análise de variância de uma por meio de, seguida do procedimento de Student-Newman-Keuls para comparação de pares múltiplos. As diferenças foram consideradas como sendo estatisticamente significantes quando p<0,05.
Resultados
1. Expressão de Ονββ em rins depois de UUO. A expressão de integrina θνβ6 em rins depois de UUO examinada por análise imunistoquími-ca. A expressão mínima de Ονββ foi detectada em rins não-lesionados (normais), enquanto a expressão supra-regulada significante foi demonstrada em 7, 10, e 14 dias depois de UUO (figura 41). Expressão detectável foi medicada logo 3 dias após UUO.
2. Inibição de imunocoloração de actina na musculatura lisa de rins de UUO com tratamento com mu3G9. A extensão da fibrose no modelo murino de UUO foi medida por análise histomorfométrica de coloração de actina da musculatura lisa-α, imunoistoquímica (corante marrom) pu coloração da matriz de colágeno com tricromo de Masson (corante azul). Em cada estudo, a proporção de área de tecido ocupada por fibrose foi determinada em camundongos de UUO recebendo veículo ou mAb de controle de isótipo (grupos de controle negativo), em grupos recebendo tratamento terapêutico de teste, e em camundongos normais não ligados. Os efeitos terapêuticos são expressos em porcentagem de inibição de coloração de matriz de colá- geno (azul) com tricromo de Masson ou coloração da actina (marrom) da musculatura lisa por cálculo da razão da diferença em área colorida entre o controle negativo e o teste terapêutico sobre a diferença entre o controle negativo e camundongos normais não ligados.
Com a finalidade de relacionar os resultados em estudos múlti- pios, os efeitos terapêuticos são expressos como percentagem de inibição de coloração da actina na musculatura lisa-α. A inibição percentual média da coloração da actina da musculatura lisa em 4 mg/kg de mu3G9, dosada i.p. três vezes por semana, para os dez dias do curso do experimento, foi de 32,8%; enquanto a rsTGF- RII-lg mostrou uma inibição percentual média de 13,2 mg/kg (Tabela 14.1 ).
Tabela 14.1. Inibição percentual média da coloração da actina da musculatura lisa-α para mu3G9 e sTGFbRII-lg contendo dados de múltiplos estudos.



Dosagem intraperitoneal, 3x/semana, por 10 dias.

Vide Tabela 14.8 para camundongos individuais em cada dose
Tabela 14.2. Inibição percentual média em UUO-4 da coloração de actina da musculatura lisa.
% Área Marrom de ASMA de UUO-4 de Tecido
Veh 3G9(1 ) 3G9(2) 3G9(4) 3G9(10) rsTGF3R(2) Norm

54 45 51 52 43 48 2

55 36 47 47 45 45 3

41 54 56 42 42 55 2

59 63 46 22 41 70 2

50 33 46 53 45 53 2

46 43 43 42 36 55 1

48 29 38 41 41 52 2

50,4 43,3 46,7 42,7 41 ,9 54,0 2,0

2,3 4,5 2,2 3,9 1 ,2 3,0 0,2
7 7 7 7 7 ' 7 7

Controle: 50,4
Sinal: 48,4
% Inib. 11 ,2 -1 ,2 -3,2 15,3 5,0
29,8 7,1 7,1 11 ,2 11 ,2
- -7,4 -11 ,5 17,4 17,4 -9,4
26,0 9,1 58,7 19,5 -40,4
36,0 9,1 -5,3 11 ,2 -5,3
15,3 15,3 17,4 29,8 -9,4

Média: 14,7 7,7 15,9 17,7 -7,4 sem: 9,4 4,5 8,1 2,4 6,2 Tabela 14.3. Inibição percentual média em UUO-6 de coloração de actina da musculatura lisa.

% Área Marrom d e ASMA d e UUO-6 de Tecido
Veh 3G9(4) 3G6(4) 4B4(4) rsTGF R(2) Norrr
38 66 33 45 40 1
34 32 31 51 51 2
30 29 42 48 52
49 40 31 37 55
57 42 48 44 45
46 45 28 43 44
60 26 57 39 41
51 28 40 36 47
45,6 38,5 38,8 42,9 46,9 1 ,5
3,8 4,7 3,5 1 ,9 1 ,9 0,5
8 8 8 8 8 2

Controle: 45,6
Sinal: 44,1 -46,2 28,6 1 ,4 12,7
% Inib. 30,9 33,1 -12,2 -12,2
37,7 8,2 -5,4 -14,4
12,7 33,1 19,5 -21 ,2
8,2 -5,4 3,7 1 ,4
1 ,4 39,9 5,9 3,7
44,5 -25,8 15,0 10,5
39,9 12,7 21 ,8 -3,1

Média: 16,1 15,6 6,2 -2,8
sem: 10,5 8,0 4,2 4,3 Tabela 14.4A. Inibição percentual média em UUO-7 da coloração de actina da musculatura lisa.
% Área Marrom de ASMA DE UUO-7 de Tecido
Veh LAP1 g(1 ) LAPIg(5) LAPIg(10) 3G9(4) Norm
31 30 33 26 18 1
39 35 35 45 21 1
49 45 33 20 13 1
45 46 14 20 24 1
39 43 17 23 18 1
40 58 56 33 13
41 55 40 23 16
52 33 35 23 21
42,0 43,1 32,9 26,6 18,0 1 ,0
2,3 3,6 4,6 3,0 1 ,4 0,0
8 8 8 8 8 5

Controle: 42,0
Sinal: 41 ,0
% Inib. 29,3 22,0 39,0 58,5
17,1 17,1 -7,3 51 ,2
-7,3 22,0 53,7 70,7
-9,8 68,3 53,7 43,9
-2,4 61 ,0 46,3 58,5
-39,0 -34,1 22,0 7,07
-31 ,7 4,9 46,3 63,4
22,0 17,1 46,3 51 ,2

Média: -2,7 22,3 37,5 58,5
sem: 8,7 11 ,3 7,3 3,4 Tabela 14.4B. Inibição percentual média em UUO-7 da coloração com tri- cromo de Masson

Tabela 14.5. Inibição percentual média em UUO-8 da coloração de actina da musculatura lisa.

% Área Marrom de ASMA de UUO-8 de Tecido
Veh sTGFbR(0.5) sTGFbR(2) rstGF3(5) Norm
38 42 13 29 2
35 42 10 31 2
36 35 32 35 1
42 23 51 39 2
47 30 30 39 1
28 35 29 27
51 31 27 32
48 30 42 41
40,6 33,5 29,3 34,1 1 ,6
2,8 2,3 4,8 1 ,8 0,2
8 8 8 8 5

Controle: 40,6
Sinal: 39,0
% Inib. -3,5 70,8 29,8
-3,5 78,5 24,7
14,4 22,1 14,4
45,2 -26,6 4,2
27,2 27,2 4,2
14,4 29,8 34,9
24,7 34,9 22,1
27,2 -3,5 -1 ,0

Média: 18,3 29,1 16,7
sem: 5,8 12,3 4,7 Tabela 14.6. Inibição percentual média em UUO-9 da coloração de actina da musculatura lisa.
% Área Marrom de ASMA de UUO-9 de Tecido
Veh 3G9(0.02) 3G9(2) 3G9(0.2) 3G9(2) rsTGF3R(2) Norm
65,0 56,0 68,0 65,0 60,0 37,0 1 ,0

69,0 59,0 63,0 60,0 64,0 56,0 2,0

80,0 63,0 57,0 24,0 63,0 34,0 1 ,0

76,0 58,0 63,0 64,0 61 ,0 42,0 1 ,0

62,0 51 ,0 54,0 52,0 57,0 52,0 2,0

58,0 44,0 62,0 64,0 53,0 56,0
61 ,0 62,0 60,0 56,0 71 ,0 56,0
64,0 66,0 73,0 67,0 38,0

66,9 57,4 62,5 55,0 62,0 46,4 1 ,4

2,7 2,5 2'1 5,5 2,0 3,4 0,2

8 8 8 7 8 8 5

Controle: 66,9
Sinal: 65,5
% Inib. 16,6 -1 ,7 2,9 10,5 45,6
12,0 5,9 10,5 4,4 16,6
5,9 15,1 65,5 5,9 50,2
13,6 5,9 4,4 9,0 38,0
24,2 19,7 22,7 15,1 22,7
34,9 7,4 4,4 21 ,2 16,6
7,4 10,5 16,6 -6,3 16,6
1 ,3 -9,4 -0,2 44,1

Média: 14,5 6,7 18,1 7,4 31 ,3 sem: 3,8 3,2 8,4 3,0 5,2 Tabela 14.7. Inibição percentual média em UUO-14 da coloração de actina da musculatura lisa.

% Área Marrom de ASMA de UUO-14 de Tecido
Veh wt3G9G1 (4) wt3G9G2a(4) agly3G9G2a(4) Norm
54 34 18 33 3
62 24 32 23 4
63 19 42 21 1
51 40 35 24 3
61 42 28 20 1
58 45 26 35
47 43 18

56.5714286 35.2857143 30.1666667 24.8571429 2,4 Média

6.07884701 10.1277554 8.02771994 6.56832225 1.34164079 S.d.

Controle: 56,6
Sinal: 54,2
% Inib. 41 ,7
60,1
69,4
30,6
26,9
21 ,4
25,1
% Inib. Média 39,3
desvio padrão 18.6900534 Tabela 4.8. Porcentagem de inibição da imunocoloração de actina da musculatura lisa em animais individuais com tratamento com mu3G9 ou com rsTGFbRII-lg.
mu3G9 mu3G9 mu3G9
0,02 0,2 mg/kg 1 mg/kg
mg/kg
% Inibição % Inibição % Inibição

UUO-9 16,6 UUO-9 -1 ,7 UUO-4 11 ,2

UUO-9 12,0 UUO-9 5,9 UUO-4 29,8

UUO-9 5,9 UUO-9 15,1 UUO-4 -7,4

UUO-9 13,6 UUO-9 5,9 UUO-4 -26

UUO-9 24,2 UUO-9 19,7 UUO-4 36

UUO-9 34,9 UUO-9 7,4 UUO-4 15,3

UUO-9 7,4 UUO-9 10,5 UUO-4 44,2

UUO-9 1 ,3 UUO-9 -9,4

média 14,5 média 6,7 média 14,7 desvio padrão 3,8 desvio padrão 3,2 desvio padrão 9,4 n 8,0 n 8 n 7

Mu3G9 Mu3G9 Mu3G9
2mg/kg Mu3G9 4mg/kg Mu3G9 10mg/kg Mu3G9
% Inibição % Inibição % Inibição

UUO-4 -1.2 UUO-4 -3,2 UUO-4 15,3

UUO-4 7.1 UUO-4 7,1 UUO-4 11 ,2

UUO-4 -11 ,5 UUO-4 17,4 UUO-4 17,4

UUO-4 9,1 UUO-4 58,7 UUO-4 19,5 Mu3G9 Mu3G9 Mu3G9
2mg/kg Mu3G9 4mg/kg Mu3G9 10mg/kg Mu3G9
% Inibição % Inibição % Inibição

UUO-4 9,1 UUO-4 -5,3 UUO-4 11 ,2

UUO-4 15,3 UUO-4 17,4 UUO-4 29,8

UUO-4 25,7 UUO-4 19,5 UUO-4 19,5

UUO-9 2,9 UUO-6 -46,2
UUO-9 10,5 UUO-6 30,9
UUO-9 65,5 UUO-6 37,7
UUO-9 4,4 UUO-6 12,7
UUO-9 22,7 UUO-6 8,2
UUO-9 4,4 UUO-6 1 ,4
UUO-9 16,6 UUO-6 44,5
UUO-6 39,9
UUO-7 58,5
UUO-7 51 ,2
UUO-7 70,7
UUO-7 43,9
UUO-7 58,5
UUO-7 70,7
UUO-7 63,4
UUO-7 51 ,2
UUO-14 41 ,7
UUO-14 60,1
UUO-14 69,4
UUO-14 30,6
UUO-14 26,9
UUO-14 21 ,4
UUO-14 25,1

Média 12,9 Média 32,8 Média 17,7

SD 4,8 SD 5,0 SD 2,4 n 14 n 30 n 7 rsTGF RII-lg
% Inibição
UUO-8 70,8
78,5
22,1
-26,6
27,2
29,8
34,9
-3,5

UUO-9 45,6
16,6
50,2
38,0
22,7
16,6
16,6
44,1

UUO-6 12,7
-12,2
-14,4
-21 ,2
1 ,4
3,7
10,5
-3,4

UUO-4 5,0
11 ,2
-9,4
-40,4
-5,3
-9,4
-3,2 média 13,2

DESVIO 5,678

PADRÃO
N2 31 REFERÊNCIAS
1. Miyajima A, Chen J, Lawrence C5 Ledbetter S5 Soslow RA, Stern J, Jha S, Pigato J, Lerner ML, Poppas DP5 Darracott Vaughan Jr. E, Felson D: Antibody to transforming growth factor-β ameliorates tubular apoptosis in unilateral ureteral obstruction. Kid Int 2000, 58:2310-2313.
2. Okada H, Kalluri R: Cellular and molecular pathways that lead to progression and regression of renal fibrogenesis. Curr Mol Med 2005, 5:467- 474.
3. Wang W, Koka V5 Lan HY: Transforming growth factor-beta and Smad signalling in kidney diseases. Nephrology 2005, 10:48-56.
4. Leask A, Abraham DJ: TGF-beta signaling and the fibrotic response. FASEB J 2004, 18:816-827.
5. Chapman HA: Disorders of lung matrix remodeling. J Clin Invest 2004, 113:148-157.
6. Sheppard D: Functions of pulmonary epithelial integrins from deve-lopment to disease. Physiol Rev 2003, 83:673-686.
7. Ihn H: Pathogenesis of fibrosis: role of TGF- beta and CTGF. Curr Opin Rheumatol 2002, 14:681 -685.
8. Norman JT, Fine LG: Progressive renal disease: fibroblasts, extra-cellular matrix, and integrins. Exp Nephrol 1999, 7:167-177.
9. Border WA, Noble NA: Interactions of transforming growth factor- -beta and angiotensin II in renal fibrosis. Hypertension 1998, 31 :181 -188.
10. Sampson NS, Ryan ST, Enlce DA, Cosgrove D, Koteliansky V, Gotwals P: Global Gene Expression Analysis Reveals a Role for the alpha 1 Integrin in Renal Pathogenesis. J Biol Chem 2001 , 276:34182- 34188.
1 . Cosgrove D, Rodgers K, Meehan D, Miller C, Bovard K, Gilroy A, Gardner H, Kotelianski V, Gotwals P, Amattucci A, Kalluri R: Integrin αΙβΙ and transforming growth factor-β 1 play distinct roles in alport glomerular pathogenesis and serve as dual targets for metabolic therapy. Amer J of Pathol 2000, 157:1649-1659.
12. Prols F, Hartner A, Schocklmann HO, Sterzel RB: Mesangial cells and their adhesive properties. Exp Nephrol 1999, 7:137- 146.

13. Hamerski DA, Santoro SA: Integrins and the kidney: biology and pathobiology. Curr Opin Nephrol Hypertens 1999, 8:9-14.
14. Zambruno G, Marchisio PC, Marconi A, Vaschieri C, Melchiori A, Giannetti A, De Luca M: Transforming growth factor-βΙ modulates BI and B5 integrin receptors and induces the de novo expression of the avB6 heterodi- mer in normal human keratinocytes: implications for wound healing. J Celi Biol 1995, 129:853-865.
15. Trevillian P, Paul H, Millar E, Hibberd A, Agrez MV: al-pha(v)beta(6) Integrin expression in diseased and transplanted kidneys. Kid-ney lnt 2004, 66:1423-1433.
16. Breuss JM, Gallo J, DeLisser HM, Klimanskaya IV, Folkesson HG, Pittet JF, Nishimura S, Aldape K, Landers DV, Carpenter W, Gillett N, Shep-pard D, Matthay MA, Albelda SM, Kramer RH, Pytella R: Expression of the B6 subunit in development, neoplasia and tissue repair suggests a role in epithelial remodeling. J Celi Sei 1995, 108:2241 -2251.
17. Breuss JM, Gillett N, Lu L, Sheppard D, Pytella R: Restricted dis-tribution of integrin B6 mRNA in primate epithelial tissues. J Histochem and Cytochem 1993, 41 :1521-1527.
18. Hakkinen L, Hildebrand HC, Berndt A, Kosmehl H, Larjava H: Im-munolocalization of tenascin-C, a9 integrin subunit, and avB6 integrin during wound healing in human oral mucosa. J of Histochem and Cytochem 2000, 48:985-998.
19. Arend LJ, Smart AM, Briggs JP: Mouse R6 integrin sequence, pat-tern of expression, and role in kidney development. J Amer Soe Nephrol 2000, 11 :2297-2305.
20. Hakkinen L, Koivisto L, Gardner H, Saarialho-Kere U, Carroll JM, Lakso M, Rauvala H, Laato M, Heino J, Larjava H: Increased expression of B6-mtegrin in skin leads to spontaneous development of chronic wounds. Am J Pathol 2004, 164:229-242.
21. Huang XZ, J. W, Spong S, Sheppard D: The integrin avB6 is criticai for keratinoeyte migration on both its known ligand, fibronectin, and on vitronectin. J Celi Sei 1998, 111 :2189-2195.

22. Munger JS, Huang X, Kawakatsu H, Griffiths MJD, Dalton SL, Wu J, Pittet JF, Kaminski N, Garat C, Matthay MA, Rifkin DB, Sheppard D: The integrin ανΒ6 binds and activates latent TGFBI: a mechanism for regulating pulmonary inflammation and fibrosis. Cell 1999, 96:319-328.
23. Busk M, Pytella R, Sheppard D: Characterization of the integrin al- pha v beta 6 as a fibronectin-binding protein. J Biol Chem 1992, 267:5790-5796.
24. Yokosaki Y, Monis H, Chen A, Sheppard D: Differential effects of the integrins alpha9betal, alphavbeta3, and alphavbeta6 on cell proliferative responses to tenascin. Roles of the beta subunit extracellular and cytoplas-mic domains. J Biol Chem 1996, 271 :24144-24150.
25. Annes JP, Rifkin DB, Munger JS: The integrin avB6 binds and activates latent TGFB3. FEBS lett 2002, 511 :65-68.
26. Munger JS, Harpel JG, Gleizes PE, Mazzieri R, Nunes I, Rifkin DB: Latent transforming growth factor- :structural feature and mechanisms of activation. Kid Int 1997, 51 : 1376-1382.
27. Gleizes PE, Munger JS, Nunes I, Harpel JG, Mazzieri R, Noguera I, Rifkin DB: TGF-beta latency: biological significance and mechanisms of activation. Stern Celis 1997, 15:190-197.
28. Khalil N: TGF-beta: from latent to active. Microbes Infect 1999, 1 :1255-1263. - 29. Barcellos-Hoff MH: Latency and activation in the contrai of TGF-β. J Mamm Gland Biol 1996, 1 :353-363.
30. Weinreb PH, Simon KJ, Rayhorn P, Yang WJ, Leone DR, Dolinski BM, Pearse BR, Yokota Y, Kawakatsu H, Atakilit A, Sheppard D, Violette SM: Function-blocking integrin alphavbeta monoclonal antibodies. J Biol Chem 2004, 279:17875-17887.
31. Ma J, Nichimura H, Fogo A, Kon V, Inagami T, lchikawa I: Accele-rated fibrosis and collagen deposition develop in the renal interstitium of an-giotensin type 2 receptor null mutant mice during ureteral obstruction. Kid Lit 1998, 53:937-944.

EXEMPLO 15: Uso de Anti-O/Be em um Modelo Murino de Fibrose Pulmonar

Induzida por Radiação
INTRODUÇÃO
Fibrose pulmonar ocorre quando remodelação desordenada da matriz segue a lesão pulmonar (Chapman 2004). Dentre muitos fatores de sinalização que estão desregulados na fibrose pulmonar, a citocina TGFp desempenha um papel particularmente importante. Em modelos animais, a inibição de sinalização de TGFp previne fibrose no pulmão, rim, fígado e pele.
Depois do processamento intracelular, TGFp e seu pró-domínio são secretados como um complexo associado covalentemente (Annes, Munger et al., 2003). TGFp ligado a seu pró-domínio é latente, isto é, não pode se ligar aos receptores de TGFp; logo, o pró-domínio é referido como peptídeo associado à latência (LAP). Além de agir como um inibidor de TGFp, LAP interage por meio de ligação de dissulfeto com proteínas da fa-mília de Proteínas de Ligação de TGFp Latente (LTBP). LTBPs são proteínas matriz e ancoram TGF latente na ECM. Liberação de TGFp a partir de LAP, um processo chamado de ativação de TGFp latente, é uma etapa necessária na por meio de de sinalização de TGFp. A etapa de ativação é um alvo potencial para estratégias de redução de sinalização de TGFp.
As integrinas θνΡβ e ( vPe ativam TGFpi e TGFp3 latentes por interação com uma sequência de aminoácidos de RGD localizada próxima aos C-terminais dos respectivos LAPs (Munger, Huang et al., 1999; Annes, Rifkin et al. 2002; Mu, Cambier et al., 2002). (TGFp2, a isoforma final de TGFp, não tem uma sequência de RGD e não pode ser ativada por essas integrinas). Dentro do pulmão, a ativação de TGFp pela integrina Ovp6 desempenha um papel não-redundante na homeostasia e resposta a lesão. θνΡβ é expressa em pequenas quantidades no epitélio de pulmão normal, mas é rapidamente supra-regulada seguinte à lesão. Camundongos carecendo do gene de p6 (Itgb6-/-) desenvolvem inflamação pulmonar e enfise-ma como resultado da reduzida sinalização de TGFp. Exposição de pulmões de camundongo à bleomicina causa lesão aguda acompanhada por um grande aumento da expressão de Ονββ, seguida por fibrose dependente de TGF ; camundongos Itgb6-/- não desenvolvem fibrose pulmonar depois de tratamento com bleomicina.
Radiação ionizante causa fibrose pulmonar (Franko e Sharplin 1994; Movsas, Raffin et al., 1997; Martin, Lefaix et al., 2000; Abratt, Morgan et al., 2004). Em contraste com o modelo de fibrose pulmonar por bleomicina, onde a fibrose começa dentro de dias depois da lesão pulmonar, a fibrose pulmonar induzida por radiação (RILF) começa meses depois da lesão. RILF murina é dependente da cepa. A cepa C57BL/6 usada nesses experimentos é suscetível. No modelo murino de RILF, há também uma substancial morte tardia ocorrendo em torno do tempo do desenvolvimento da fibrose; essa mortalidade é provável devido à perda de perfusão no pulmão (Franko, Nguyen et al., 1996; Haston, Zhou et al., 2002). Um mAb anti-oc^ inibidor (3G9) foi desenvolvido (Weinreb, Simon et al., 2004). As metas desses estudos foram: (1 ) estabelecer a dependência de θνβ6 de RILF em uma cepa de camundongo suscetível por comparação das respostas de Itgb6+/+ e Itgb6-/-à radiação torácica, (2) confirmar a dependência de TGF do modelo murino de RILF por tratamento de camundongos irradiados com um antagonista de TGF (receptor de TGF solúvel) e (3) confirmar os efeitos de várias doses de 3G9 dadas aos camundongos irradiados.
MATERIAIS E MÉTODOS
1 . Animais. Todos os camundongos usados eram camundongos fêmeas ligb6-/- e foram um presente de Dean Sheppard, UCSF, e foram criados nessa instalação em um background C57BL/6. Camundongos do tipo selvagem foram C57VL/6 adquiridos de Jackson Laboratory (Bar Harbor, ME), de 7 a 9 semanas de idade na chegada e deixados uma semana para aclimatização nessa instalação de animais antes da radiação. Todos os procedimentos de manuseio de animais e experimentos foram aprovados pelo comité de assistência a animais da New York University School of Medicine e conformados às diretrizes de NIH para o cuidado e uso de animais de laboratório. As gaiolas foram restringidas a um máximo de 5 camundongos por gaiola de acordo com o protocolo de instalação para animais. Os camundongos foram monitorados diariamente quanto à morbidade e à mortalidade.

Camundongos moribundos foram sacrificados.
2. Anticorpos. Dois anticorpos foram obtidos da Biogen Idec (Cambridge, MA), e foram preparados conforme descrito em algum lugar aqui. O anticorpo primário testado, 3G9, é um mAb anti-ctvpe que bloqueia a ativação de TGFp mediada por ανβ6. Esse é um subtipo de lgG1 e se liga a ανββ em um modo independente de cátion. O Ab de controle (1 E6) era um Ab monoclonal de lgG1 de LFA-3 antihumano de camundongo que não interage com LFA-3 de camundongo. Doses desse Ab de controle até 200 mg/kg/semana por 4 semanas em camundongos normais não mostraram toxicidade (dados da Biogen Idec). Alíquotas de anticorpo foram preparadas como diluições em PBS estéril para obter doses de 0,3, 1 , 3, 6, e 10 mg/kg em um volume total de 200 microlitros. Injeções subcutâneas no flanco direito ou injeções intraperitoneais, dependendo do experimento, começaram na semana 15 pós-irradiação.
3. Protocolo de Radiação. Os camundongos foram irradiados quando estavam com 8 a 10 semanas de idade. Antes da irradiação, anestesia foi conseguida usando Avertin (2,2,2-tribromoetanol; Acros Organics, NJ) com 15 nL/g de uma solução a 2,5% distribuída intraperitonealmente. Os camundongos foram então posicionados em supino com filamento adesiva em uma superfície de Plexiglass. Posicionamento adequado com blindagem de chumbo restringiu a radiação ao tórax. O campo do nível do ápice para o processo xifóide foi de 1 ,8 cm. Uma fonte de 60Co foi usada para prover irradiação de 14 Gy. A distância da fonte para a pele era de 65 cm. O tempo de exposição com essa fonte foi de -11 minutos. Depois da exposição à radiação, os camundongos foram levados de volta para suas gaiolas e posicionados com a face para cima e monitorados durante a recuperação.
4. Coletas de amostras dos camundongos sacrificados. Os camundongos que sobreviveram em pontos de tempos predeterminados pós-radiação (26, 28 ou 32 semanas para os estudos de anticorpo) foram sacrificados e processados da seguinte maneira. Depois de anestesia profunda ter sido obtida com Avertin, etanol a 70% foi aspergido sobre a pele torácica e abdominal. A cavidade torácica foi aberta através do diafragma. 400-500 μΐ de sangue foram aspirados diretamente dos ventrículos. A traquéia foi exposta e canulada com um angiocateter de calibre 22. Os pulmões foram lavagens duas vezes com alíquotas de 700 μΐ.. O brônquio do canal principal direito foi ligado ao hilo, e cada lobo foi removido e colocado em um tubo separado, congelado rapidamente em nitrogénio líquido, e armazenado a - 80°C. O pulmão esquerdo foi inflado com 400 μΙ_ de formalina a 0%, colocado em formalina a 10% durante a noite e embutido em parafina. O fluido de lavagem broncoalveolar (BAL) obtido na ocasião do sacrifício foi dividido em duas alíquotas: 200 μΙ_ e o restante. Ambos os tubos foram centrifugados em 2.000 rpm, por 3 minutos. Os sobrenadantes de ambos os tubos foram combinados, congelados em nitrogénio líquido e armazenados a -80°C. O pélete de células do tubo mais largo foi congelado instantaneamente e armazenado do mesmo modo. A alíquota de 200 μΙ_ do precipitado de células foi ressuspensa com 200 μΙ_ de tampão de lise RBC e misturada inteiramente. 50 μΙ_ foram usados para contagem de células em um hematocitômetro. Os 150 μL· restantes foram usados para preparações de citospina. O sangue obtido por punção cardíaca foi usado para fazer soro ou plasma como a seguir. Depois de misturamento inicial em tubos Capiject ou tubos de micro-centrífuga de 1 ,5 cm3 heparinizados, as amostras foram centrifugadas a 14.000 rpm por 20 minutos. Os sobrenadantes foram removidos e imediatamente congelados a -80°C. - 5. Coletas de amostras de camundongos encontrados mortos ou moribundos. Os camundongos que foram encontrados mortos ou moribundos antes de alcançarem a data de sacrifício foram dissecados para obter espécimes de pulmão. Os camundongos moribundos foram eutanizados com Avertin antes da dissecação. A cavidade torácica foi aberta através do diafragma. Foi realizada dissecação até a traquéia com exposição completa. A traquéia foi canulada com um angiocateter de calibre 22. Os pulmões foram inflados com 800-1.000 μ1_ de formalina a 10%. O conteúdo da cavidade torácica foi removido em bloco e colocado em formalina a 10% por pelo menos 24 horas antes da separação do pulmão e embutido em parafina.
6. Diferenciação celular. Preparações de citopsina foram colori- das pelo método DiffQuik (imersões de 15 segundos sequencialmente em Fixador, 1% de Eosina-Y, 1% de Azure A, e água deionizada). As lâminas foram então desidratadas e montadas. Os números de neutrófilos, linfócitos, e macrófagos foram manualmente contados em dois campos de alta energi- a, separados (400x).
7. Imunoistoquímica. Algumas das amostras fixadas em formali- na foram usadas para detecção imunoistoquímica de β6. A atividade de pe- roxidase endógena foi extinta com peróxido de hidrogénio a 3% em metanol por 15 minutos, e recuperação de antígeno foi obtida por aplicação de Di-gest-AII 3 Pepsina (Zymed, South San Francisco) por 5-7 minutos. A solução de bloqueio de Avidina/Biotina (Vector Laboratories, Burlingame, CA) foi u-sada de acordo com as instruções do fabricante. O bloqueio foi com solução de caseína a 0,5% por 15 minutos. O anticorpo monoclonal anti-ββ ch2A1 (Biogen Idec), que consiste na região variável de um mAb anti-ββ de camundongo clonado em um IgG humano, foi usado em uma diluição de 1 :500 em BSA a 0,1%, por 1 hora, à temperatura ambiente. A detecção foi alcançada usando um kit Vectastain ABC (Vector Laboratories) com um anticorpo secundário antihumano de acordo com as instruções do fabricante. A geração de cromógeno foi feita com um kit DAB (Sigma, St. Louis, MO), seguida por contra-coloração com hematoxilina. A especificidade do procedimento foi confirmada pela omissão do anticorpo em seções tratadas em paralelo, o que foi feito rotineiramente, e por testes preliminares em seções do pulmão de camundongos Itgb6-/-, que deram resultados negativos.
8. Seções de pulmão, coloração de tricromo, e determinação percentual de fibrose. Os pulmões fixados em formalina, embutidos em parafina, foram seccionados transversalmente para 5 micra de espessura. As seções de pulmão foram obtidas em ou próximo ao hilo por estimativa visual. As lâminas foram desparafinizadas com água deionizada (banho de Xileno x 2 por 3 minutos cada, etanol a 100% x 2 por 3 minutos cada, etanol a 95% x 2 por 3 minutos cada, 70% etanol x 3 minutos, deionizadas com água x 3 minutos). As seções foram coloridas com corante de tricromo de Masson (a solução de Bouin durante a noite para mordente, ferro hematoxilina de Wei- gert por 5 minutos, Fucsina ácida Escarlate de Biebrich por 5 minutos. Solução de Ácido fosfotúngstico/fosfomolíbdico por 5 minutos, Solução de Azul de anilina por 5 minutos, enxágúes com água deionizada, no intervalo, e Á- cido acético a 1 % por 2 minutos). As lâminas então desidratadas (etanol a 70%, etanol a 95%, etanol a 100%, e xileno), e montadas usando Permount.
A técnica de percentual de fibrose descrita por Haston et al. (Câncer Res 2002, 62:372-8) foi usada. Imagens de baixo poder (2-3X) de seções de pulmão coloridas com tricromo foram obtidas e salvadas em formato digital. Inspeção manual de alto poder (100-200X) das seções de pul- mão foi realizada por microscopia de luz para identificar as regiões de fibrose (definidas por aumentada deposição de colágeno e perda da arquitetura). Áreas de seção transversal de fibrose juntamente com a área de seção transversal total da seção de pulmão foram mostradas na imagem digital suando o software NIH Image .62. A soma das áreas da fibrose foi dividida pela área total do pulmão para estabelecer o percentual de fibrose. Uma seção transversal aleatória do pulmão mostrou que reflete o percentual de fibrose no pulmão inteiro quando em comparação com as 10 seções aleatórias (Haston, Amos et al., 1996).
9. Ensaio de Hidroxiprolina. A medição do teor de hidroxiprolina foi adaptada do método de Reddy e Enwememka. O pulmão direito foi removido e pesado. O tecido pulmonar (cerda de 20 mg de peso úmido) foi incubado em 400 μΙ_ de solução 2N de NaOH por 12 horas (temperatura ambiente), e então homogeneizado. Os homogeneizados e soluções padrão de hidroxiprolina foram hidrolisados por aquecimento para 120°C, por 30 minutos. Solução de Cloramina-T (0,056M, 450 μΙ_) foi adicionada a 50 μΙ_ de hidrolisado e foi deixada que a oxidação prosseguisse por 25 minutos. Reagente de Ehrlich (1 M, 500 μΐ.) foi adicionado e foi deixado que a cor fosse revelada, por 20 minutos, a 65°C. Absorbância em 550 nm foi então medida. As concentrações finais são expressas como μg de hidroxiprolina/mg de tecido de pulmão úmido.
10. Medições de Razão Mássica RV/LV. Os camundongos usados para este experimento foram em um coorte que foi sacrificada em 32 semanas pós-irradiação; mais sete camundongos C57BIJ6 não irradiados foram usados como controles. Os corações dos camundongos irradiados que morreram entre 28 e 32 semanas ou de camundongos que sobreviveram para serem sacrificados com 32 semanas. Os corações foram fixados em formalina. Sob o microscópio de dissecação, os átrios foram removidos, e a parede livre ventricular direita (RV) foi dissecada sendo separada do ventrículo esquerdo e do septo (LV). Cada pedaço do tecido ventricular foi pesado, e a razão foi calculada. Sete camundongos C57BL76 não irradiados foram usados como controles.
11. Estatística. A significância estatística das diferenças percentuais de fibrose entre grupos foi realizada usando o teste de Mann-Whitney para dados não paramétricos. As datas de morte foram registradas e usadas para criar curvas de Kaplan-Meier. Comparações por grupo individual bem como comparações totais das curvas de Kaplan-Meier foram feitas com teste de Log-Rank (Mantel-Cox). Valores médios são reportados com o erro padrão correspondente do desvio médio ou padrão. Para comparação das médias das medições da razão mássica de RV/LV, foi usado o teste t de Stu- dent (não-pareado, 2 caudas). O teste exato de Fisher foi usado para comparar a presença ou ausência de fibrose entre os camundongos Itgb6-/- e Itgb6+/+. A significância estatística foi definida como p<0,05.
_ RESULTADOS
1. RILF murina requer expressão de ανββ: comparação de camundongos Itgb6+/+ e Itgb6-/- depois da radiação torácica. Esse experimento foi projetado para comparar a expressão de θνββ na linha de base e pós- radiação e para determinar se a ausência de ανββ preveniu fibrose. Os camundongos Itgb6-/- e Itgb6+/+ foram irradiados e sacrificados em vários pontos de tempo antes e nas 28 semanas.
(a) β6 é supra-regulado na 18-20 semanas pós-irradiação. Os camundongos sacrificados, antes das 18 semanas pós-irradiação, tiveram expressão de ανββ, baixa, normal, conforme medida por imunoistoquímica. Contudo, nas 18 semanas, é vista a expressão aumentada difusamente de Ονββ em todo o epitélio alveolar (figura 42).

(b) Alta expressão de Ονββ persiste nas regiões fibróticas. Foram observados consistentemente altos níveis de expressão de ανββ nas células epiteliais dentro das lesões fibróticas, independentemente do tempo desde a irradiação (figura 43). Contudo, a expressão aumentada difusa de ανββ observada nas 18 semanas é frequentemente menos evidente em pontos de tempo mais tarde (figura 43, compare 24 semanas e 27 semanas).
(c) Camundongos carecendo de ανββ não desenvolvem RILF. Nos camundongos de controle, o ponto de tempo mais cedo, no qual as á- reas de fibrose poderiam ser discernidas foi de 20-22 semanas pós- irradiação (não mostradas). As áreas fibróticas são tipicamente bem demarcadas e subpleurais. Não foi encontrada nenhuma área de fibrose nas se-ções de pulmão de camundongos Itgb6-/- sacrificados 27 semanas pós-irradiação (N=17). Em contraste, foram encontradas áreas fibróticas em se-ções de 21/23 camundongos Itgb6+/+, uma diferença que é estatisticamente Significante (p<0,001 , teste exato de Fisher, 2 caudas) (figura 44). A % média de área de fibrose das seções de camundongos Itgb6+/+ (27 semanas depois da irradiação) foi de 17% +/- 3%. Confirmamos os achados histológicos por medição do teor de hidroxiprolina dos pulmões de camundongos Itgb6+/+ e Itgb6-/-, 27 semanas pós-radiação (figura 45).
(d) Ausência de Ονβε não afeta a sobrevivência depois da irradiação do pulmão. Depois da radiação torácica com 14 Gy, a mortalidade foi desprezível até 18 semanas pós-irradiação, e alcançou 50% em aproximadamente 25 semanas pós-irradiação. Não houve diferença significante entre as curvas de sobrevivência dos camundongos Itgb6+/+ e Itgb6-/- (figura 46).
2. Efeito do 3G9 (0,3, 1 e 1 mg/kg/semana de dosagem IP) e TGF R solúvel em modelo de RILF murina. Os resultados anteriores indicam que RILF é dependente da expressão de integrina ανββ, e que a falta de ( νββ não piora a mortalidade pós-radiação. A exigência por ανββ é consistente com sua função conhecida como ativador de ΤβΡβΙ latente. Esses resultados também sugerem a exequibilidade da inibição de ανββ como uma estratégia antifibrose. Para testar essa idéia e para confirmar que o modelo murino de RILF é dependente de ΤβΡβ, os camundongos irradiados foram tratados com um Ab de controle, receptor de TGFp, ou uma de três doses de 3G9 (N=27 por grupo). Um número menor de camundongos (N=15) foi tratado com injeções de PBS (200 μΙ_), somente. 3G9 foi usado em doses de 0,3, 1 e 10 mg/kg, o Ab de controle foi usado em 10 mg/kg, e o receptor de TGF solúvel foi usado em 5 mg/kg. Os tratamentos foram iniciados nas 15 semanas pós-irradiação (aproximadamente três semanas antes da super- regulação de Ονββ) e continuou semanalmente até o sacrifício nas 26 semanas pós-irradiação (vide métodos para detalhes).
(a) 3G9 e receptor de TGFp solúvel decrescem a fibrose. Todos os camundongos sobreviventes foram sacrificados nas 26 semanas pós^. irradiação. Enquanto o grupo de 0,3 mg/kg não mostrou redução no percentual de fibrose em comparação com os controles, o grupo de 1 mg/kg mostrou uma significante redução de fibrose. Embora o receptor de TGFp solúvel e os grupos de 10 mf/kg tenham mostrado menos fibrose que os controles, o resultado não atingiu significância estatística na análise de somente camundongos sacrificados (figura 47), É possível que os camundongos que morreram antes do ponto de tempo do sacrifício planejado diferiram biologicamente dos camundongos sobreviventes. Portanto, foi realizada uma análise similar em todos os camundongos que morreram ou que foram sacrificados no período do estudo. Quando todos os camundongos foram considerados (camundongos sacrificados e morrendo antes de serem sacrificados), estava presente fibrose significantemente menor nos grupos de 1 mg/kg, 10 mg/kg, e de receptores de TGFp solúveis em comparação com os controles. De novo, os grupos de 0,3 mg/kg não tiveram uma diferença significante em com-paraçao com os controles (figura 48).
(b) 3G9 na dose de 10 mg/kg causa uma alveolite neutrofílica e linfocítica. A realização de BAL em todos os camundongos sacrificados revelou percentagens aumentadas de neutrófilos e linfócitos no grupo que 10 mg/kg em comparação com os controles (figura 49). Os outros grupos não mostraram aumentos similares.
(c) bloqueio de ανββ por meio de anticorpos em doses mais baixas não afeta a sobrevivência após a irradiação do pulmão. Não houve dife- rença significante na sobrevivência quando todos os grupos foram comparados (p = 0,088; comparação de todos os grupos pelo teste de log-rank Man- tel-Cox). Contudo, uma tendência para mortalidade aumentada no grupo de 10 mg/kg estava aparente (figura 50). Se somente os grupos de 10 mg/kg/semana e grupos de controle são comparados (isto é sem correção para comparações múltiplas), a diferença entre as curvas de sobrevivência é estatisticamente significante.
3. Efeito de 3G9 (1 , 3, 6 e 10 mg/kg/semana em dosagem SC) em modelo murino de RILF. Os resultados prévios indicam que a RILF no modelo murino é mediada por TGFp, e é significantemente reduzida por 3G9 nas doses de 1 mg/kg e 10 mg/kg. Contudo, inflamação alveolar aumentada e uma tendência à mortalidade aumentada estão presentes na dose de 10 mg/kg. Nesse experimento, fibrose em pontos de tempo mais tardios foi avaliada (até 32 semanas pós-irradiação) para testar a possibilidade de o tratamento com 3G9 ter simplesmente retardado o início da RILF por várias semanas em vez de preveni-la. Também, para melhor definir as diferenças na inflamação alveolar e possivelmente na sobrevivência entre as doses de 1 e 10 mg/kg, foram testadas doses adicionais entre 1 e 10 mg/kg. Duzentos e setenta camundongos foram irradiados e divididos em grupos iguais para receber uma das quatros doses de 3G9 (1 , 3, 6 e 10 mg/kg) ou o Ab de controle (10 mg/kg). Os tratamentos foram iniciados em 15 semanas pós-irradiação e continuaram, semanalmente, até uma data posterior do sacrifício. O experimento foi feito com 2 grupos de camundongos irradiados cerca de um mês um do outro. Em um grupo, os camundongos que começaram o tratamento seriam sacrificados se eles tivessem sobrevivido às 28 semanas pós-irradiação (Grupo 1 ), e no outro grupo se eles houvessem sobrevivido às 32 semanas (Grupo 2). Os anticorpos foram dados subcutaneamente (não IP como no experimento anterior).
(a) 3G9, em doses de 1 , 3, 6 e 10 mg/kg, diminui a fibrose. Níveis de fibrose significantemente diminuídos foram observados em todos os grupos que estavam recebendo 3G9 em comparação com os controles (p< 0,01). Essas diferenças foram significantes em camundongos encontrados mortos ou moribundos, camundongos sacrificados nos pontos de tempo final, e todos os camundongos combinados (figura 51 ).
(b) 3G9 em doses mais altas causa alveolite neutrofílica e linfocí- tica. Realização de BALs em todos os camundongos sacrificados (N=101 ) revelou percentagens mais altas de neutrófilos e linfócitos (figura 52) nos grupos de 3 mg/kg, 6 mg/kg, e 10 mg/kg em comparação como os controles (p<0,02). Também, percentagens significantemente mais altas estavam presentes no grupo de 10 mg/kg em comparação com o grupo de 1 mg/kg (p<0,001 ). Qualitativamente, números aumentados de macrófagos "espumosos" (idênticos àqueles vistos nos camundongos Itgb6-/-) e fragmentos celulares são vistos em doses mais altas (figura 53).
(c) 3G9 em uma de 6 mg/kg está associada à sobrevivência reduzida. Não houve diferença de mortalidade entre o grupo de controle em comparação com os grupos de 1 mg/kg e 3 mg/kg (figuras 54 e 55). Contudo, houve uma mortalidade significativamente maior no grupo de 6 mg/kg em comparação com os controles (p< 0,05). O grupo de 10 mg/kg não teve uma redução de sobrevivência em comparação com os camundongos de controle. O grupo de 3G9 de 6 mg/kg/semana apresentou fraca sobrevivência em ambas as coortes de sacrifício nas 28 semanas (Grupo 1 ) e nas 32 semanas de sacrifício (Grupo 2), embora a diferença seja mais proeminente no grupo de 28 semanas (figuras 54 e 55).
(d) Efeito da irradiação no pulmão na razão mássica de RV/LV é perfusão pulmonar. Estudos anteriores sugeriram que mortes durante a fase de fibrose depois da irradiação do pulmão são devido à angústia respiratória resultante de uma combinação da obstrução do espaço aéreo (principalmente devido à fibrose) e perda de perfusão alveolar (Sharplin e Franko, 1989). A perda de perfusão deveria levar à hipertensão arterial pulmonar e hipertrofia ventricular direita, e massa de RV aumentada tem sido reportada nesse modelo. A razão mássica de RV/LV dos camundongos que sobreviveram às 32 semanas e dos camundongos da mesma coorte, que sobreviveram entre 28 e 32 semanas foi medida. Os camundongos que morreram tinham uma razão de RV/LV significantemente aumentada em comparação com os ca- mundongos que sobreviveram e em comparação com os camundongos não- irradiados (figura 56). Além disso, em alguns camundongos que morreram, foram observadas áreas distintas com ausência completa de eritrócitos nas paredes alveolares, uma constatação que é indicativa da perda completa de perfusão alveolar (figura 57).
DISCUSSÃO

TGF é conhecida como sendo um mediador pró-fibrótico. Trabalho anterior mostrou que a integrina ανββ ativa TGFpl e TGF 3 latentes e que camundongos Itgb6-/- estão também protegidos da fibrose pulmonar induzida por bleomicina. Os resultados apresentados aqui indicam que os camundongos Itgb6-/- estão também protegidos da fibrose pulmonar induzida por radiação. Esses resultados proporcionam uma explanação para a terapia anti-fibrose alvejando a integrina Ονβε.
Nesses estudos, foi verificado que 3G9 administrado nas doses de 1 mg/kg/semana reduziu a RILF de modo consistente e eficaz. Doses mais altas, particularmente doses de 6-10 mg/kg/semana, foram associadas às percentagens aumentadas de neutrófilos e linfocitos no fluido do BAL. Essas alterações estão consistentes com o fenótipo dos camundongos Itgb6-/- e sugerem que essas doses de 3G9 são inibidoras da ativação de TGFp mediada por ανββ em tal extensão que os animais fazem fenocopiam os nocautes. - Além disso, doses mais altas de 3G9 estão associadas, variavelmente, à sobrevivência diminuída do modelo murino de RILF. Na primeira experiência houve uma forte tendência à mortalidade aumentada com a dose de 10 mg/kg/semana, mas não nos camundongos tratados com 1 ou 0,3 mg/kg/semana. Na segunda experiência houve mortalidade aumentada no grupo de 6 mg/kg/semana, mas não nos outros grupos (incluindo 10 mg/kg/semana). Embora as razões para as discrepâncias em dose/resposta não estejam claras, o resultado geral é uma tendência à sobrevivência nas doses mais altas testadas.
As mortes que ocorrem no modelo de RILF parecem ser devido à angústia respiratória. A mortalidade é dependente da cepa e dependente do sexo (Haston, Zhou et al., 2002). As causas da disfunção pulmonar e da mortalidade no modelo murino de RILF têm sido extensivamente estudadas (Sharplin e Franko, 1989). Os autores desse estudo concluíram que a perfusão pulmonar é reduzida depois da radiação, e esse déficit provavelmente contribui para a mortalidade. Os camundongos que são resistentes à fibrose induzida por radiação também têm sobrevivência diminuída no modelo de fibrose pulmonar induzida por radiação. Tem se constatado que a perfusão pulmonar diminuída nesses camundongos é um fator contributivo principal para a morte nesse modelo. O padrão de déficit de perfusão depende da cepa. Em camundongos propensos à fibrose, a perda completa de perfusão (como julgado pela presença ou ausência de carbono coloidal injetado intra-venosamente 30 segundos antes do sacrifício) é restrita às áreas de fibrose e pequenas áreas ocasionais adjacentes às lesões fibrosas. Além disso, houve uma maior variabilidade de região para região na quantidade de car-bono em áreas perfundidas nos camundongos irradiados que nos controles não-irradiados, sugerindo que houve áreas substanciais com perfusão reduzida, mas não ausente. Outra evidência para a perda de perfusão pulmonar, vista nas múltiplas cepas de camundongos, foi um número reduzido de vasos sanguíneos pequenos no pulmão isento de lesão, e hipertrofia de RV conforme avaliação da razão de espessura. Os números de eritrócitos nas paredes alveolares (um método diferente de avaliar a perfusão) estavam também reduzidos nos camundongos irradiados (cepa A/J). A maioria dos camundongos C57BL/6 não teve efusões pleurais. Exceto pela cepa C57BL710J, o dano no miocárdio não ocorreu como uma consequência da irradiação.
Essas observações sobre mortalidade são consistentes com as observações mais extensivas de Sharplin e Franko. Nos camundongos de controle, a quantidade de fibrose é maior nos camundongos que morreram que naqueles que sobreviveram para serem sacrificados (figura 51), sugerindo que maior disfunção pulmonar está associada à morte. Os camundon-gos que morrem têm hipertrofia ventricular direita (definida como um aumento do índice mássico de RV/LV), ao passo que os camundongos que sobreviveram para serem sacrificados não tinham (figura 56), uma observação que sugere que a perda de perfusão pulmonar está associada à morte. Em alguns camundongos que foram encontrados mortos, as áreas do pulmão carecendo de eritrócitos nas paredes alveolares estavam evidentes nas se- ções histológicas (figura 57), consistente com a perda completa de perfusão naquelas áreas e consistente com as descrições anteriores (Sharplin e Fran- ko, 1989). Nem evidência de disfunção esofágica (formação de cicatriz, perfuração) que seria responsável pelas mortes, nem necrose no miocárdio, foi observada. Assim, a evidência, interpretada à luz do trabalho anterior, sugere que a perda de perfusão pulmonar ocorre em camundongos C57BLJ6 mesmo quando a fibrose é prevenida e que a perda de perfusão pulmonar, não a fibrose, é responsável pela morte. Também foi notado que os camundongos estavam mais propensos a morrerem durante os dois dias após as injeções (tanto com Ab de controle como 3G9), sugerindo que o estresse no manuseio, e talvez o volume extra de fluido da injeção, tenha acelerado a morte dos camundongos marginais.
Embora a perda de ανββ por ablação de gene não afete a mortalidade nesse modelo, altas doses de 3G9 (6 a 10 mg/kg/semana) estavam associadas à morte mais precoce em comparação com os camundongos tratados com dose mais baixa de 3G9 ou Ab de controle. A interpretação mais óbvia é que dose maior de 3G9 piora a mortalidade. Contudo, não se pode excluir a possibilidade de que o Ab de controle e as doses menores de 3G9 aumentem a sobrevivência. Comparação do tempo para 50% de sobrevivência para os três experimentos parece revelar dois grupos. Camundongos do tipo selvagem e Itgb6-/- (figura 46), os camundongos tratados com PBS e os tratados com 10 mg/kg/semana de 3G9 no experimento IP (figura 50), e os camundongos tratados com 6 mg/kg/semana de 3G9 no experimento SC (figura 54) têm tempos médios de sobrevivência de -22,5-25 semanas, ao passo que todos os outros grupos de tratamento têm tempos de sobrevivência média de -24,5-30 semanas (figuras 50 e 54). Conclusões definitivas nesse ponto não são possíveis porque as condições experimentais variaram e outras condições podem ter sido alteradas entre os experimentos, causando mudanças na mortalidade de linha de base. Nos camun- dongos tratados com 3G9 em 6 a 10 mg/kg/semana, não foram observadas novas anormalidades (diferentes de inflamação do pulmão) que poderiam ser responsáveis pelas alterações na sobrevivência em uma inspeção geral dos camundongos na dissecação e na histologia do pulmão. As razões para diferenças na sobrevivência entre doses mais baixas e mais altas de 3G9 no modelo de RILF não são conhecidas.
Esses estudos fundamentam a conclusão que doses mais baixas de 3G9, que presumivelmente não reduzem ao máximo a ativação de TGFp mediada por ο ββ, previnem seguramente a fibrose pulmonar no modelo murino de RILF.
REFERÊNCIAS
Abratt, R. P., G. W. Morgan, et al. (2004). "Pulmonary complications of radiation therapy." Clin Chest Med 25(1 ): 167-77.
Annes, J. P., J. S. Munger, et al. (2003). "Making sense of latent TGFp activation." J Celi Sei 116(Pt 2): 217-24.
Annes, J. P., D. B. Rifkin, et al. (2002). "The integrin ανβ6 binds and activates latent TGF 3." FEBS Lett 511 (1 -3): 65-8.
Chapman, H. A. (2004). "Disorders of lung matrix remodeling." J Clin Invest 113(2): 148-57.
Franlco, A. J., G- K. Nguyen, et al. (1996). "A comparison of the ul-trastructure of perfusion-deficient and functional lung parenchyma in CBA mice during the late phase after irradiation." Radiat Res 146(5): 586-9.
Franko, A. J. and J. Sharplin (1994). "Development of fibrosis after lung irradiation in relation to inflammation and lung function in a mouse strain prone to fibrosis." Radiat Res 140(3): 347-55.
Hasten, C. K., Cl. Amos, et al. (1996) "Inheritance of susceptibility to bleomycin-induced pulmonary fibrosis in the lung." Câncer Res 56(11): 2596-601.
Haston, C. K., X. Zhou, et al. (2002). "Universal and radiation-specific loci influence murino susceptibility to radiation-induced pulmonary fibrosis." Câncer Res 62( 3): 3782-8.
Martin, M., J. Lefaix, et al. (2000). "TGF-βΙ and radiation fibrosis: a master switch and a specific therapeutic target?" Int J Radiat Oncol Biol Phys 47(2): 277-90.
Movsas, B., T. A. Raffm, et al. (1997). "Pulmonary radiation injury." Chest 11 1 (4): 1061 -76.
Mu, D., S. Cambier, et al. (2002). "The integrin ανβ8 mediates epithe- lial homeostasis through MTI-MMP-dependent activation of TGF-betal." J Cell Biol 157(3): 493-507.
Munger, J. S., X. Huang, et al. (1999). "The integrin ανβ6 binds and activates latent TGF i: a mechanism for regulating pulmonary inflammation and fibrosis." Cell 96(3): 319-28...
Sharplin, J. and A. J. Franko (1989). "A quantitative histological study of strain-dependent differences in the effects of irradiation on mouse lung during the intermediate and late phases." Radiat Res 119(1 ): 15-31.
Weinreb, P. H., K. J. Simon, et al. (2004). "Function- blocking integrin ανβ6 monoclonal antibodies: distinct ligand-mimetic and nonligand-mimetic classes." J Biol Chem 279(17): 17875-87.
EXEMPLO 16: Eficácia de um Anticorpo Monoclonal Anti-integrina ανββ na

Fibrose Pulmonar Induzida por Bleomicina.
SUMÁRIO
Tratamentos correntes para fibrose pulmonar são altamente ineficazes e existe uma grande necessidade de se desenvolver novas substâncias terapêuticas. Agentes que bloqueiam a por meio de de TGF são de particular interesse devido ao papel central do TGF-β no acionamento de muitos dos processos patológicos que caracterizam a fibrose pulmonar, inclusive ativação e proliferação de fibroblastos, e expressão de moléculas da matriz extracelular. Além de suas atividades pró-fibróticas, TGF-β é uma importante citocina antiinflamatória, e assim a inibição terapêutica de TGF-β bloquearia idealmente a fibrose sem promover excesso de inflamação. Trabalho prévio tem demonstrado que a integrina ονββ é um mediador chave da ativação TGF-β in vivo, particularmente no pulmão, ονβε se liga diretamente aos complexos de TGF-β latente no espaço extracelular e esta ligação é, em muitos casos, requerida para liberação da forma ativa. Camundongos defici- entes de ο ββ têm inflamação pulmonar devido à sinalização de TGF-β comprometida no pulmão e são resistentes à fibrose pulmonar induzida por blê- omicina. Foram desenvolvido anticorpos monoclonais que bloqueiam a ligação de Ονββ ao TGF-β latente e inibem a ativação de TGF-β e subsequente sinalização. Aqui foi demonstrado que esses anticorpos são eficazes na atenuação de fibrose induzida por bleomicina em camundongos. Foi mostrado ainda que eficácia próxima da máxima na atenuação da expressão de colá-geno no pulmão pode ser obtida em doses que não produzem inflamação adicional, conforme medida por números de células inflamatórias no lavagem broncoalveolar. Embora doses mais altas do anticorpo, que também atenuam fibrose, possam induzir inflamação consistente com o que é visto nos camundongos deficientes de ανββ· Essas constatações demonstram que os efeitos pró-inflamatórios e antifibróticos de bloqueio de TGF-β mediado por νββ são separáveis nesse modelo, e que a inibição da fibrose ocorre em doses inferiores aos efeitos pró-inflmatórios.
INTRODUÇÃO
A citocina TGF-βΙ é central para ambas as iniciação e manutenção de fibrose, um processo patológico marcado por reposição do tecido doente com matriz extracelular em excesso (ECM) e levando ultimamente à formação de cicatriz no órgão e insuficiência. TGF-βΙ promove proliferação de fibroblastos e a ativação de miofibroblastos, que são responsáveis pela secreção de ECM e por manter a progressão do processo fibrótico [1 -6]. TGF-βΙ desempenha um papel bem regulado nos eventos de remodelação de tecido que ocorrem durante a cura de ferimento; contudo, em várias doenças deste processo a remodelação de tecido se torna aberrante e é caracterizada por sinalização de TGF-β supra-regulada prolongada, excesso de acúmulo de fibroblastos, deposição de ECM, e formação de cicatriz. A importância de TGF-βΙ na progressão da fibrose in vivo tem sido mostrada tanto por estudos de ganho de função bem como através de bloqueio [1 , 7-12]. Superexpressão adenoviral e transgênica de várias citocinas no pulmão têm mostrado que TGF-βΙ é único em sua capacidade de promover fibrose na ausência de inflamação significante. Outras citocinas que promovem fibrose frequentemente o fazem por supra-regulação de expressão de TGF-βΙ no tecido. Além disso, estudos têm mostrado que camundongos deficientes no- cauteadas de SMAD3, um mediador de sinalização de TGF-β, são resistentes ao desenvolvimento de fibrose pulmonar [13]. Numerosos estudos com agentes anti-a^ mostram proteção profunda da fibrose em modelos de doença [8, 9, 11 ,14-17]. Consequentemente, TGF-βΙ tem sido identificado como um alvo terapêutico potencial para o tratamento de doenças associadas à patologia de fibrose.
A integrina νββ tem sido identificada como um regulador crítico da ativação de TGF-βΙ . TGF-βΙ é sintetizado como proteína latente que é clivada e secretada com o LAP N-terminal não covalentemente associado à citocina TGF-β C-terminal. O complexo de TGF-βΙ latente não pode se ligar ao seu receptor cognato e assim permanece biologicamente inativo, até convertido na forma ativa por um dos vários mecanismos alternativos que incluem clivagem por proteases, exposição a pH baixo ou radiação ionizante, e alterações conformacionais no complexo latente permitindo que ele se ligue a seus receptores cognatos [18-21]. A integrina Ονββ se liga a um motivo de RGD no complexo de TGF-βΙ latente e a converte em uma forma ativa. [18,22-25]. Embora vários outros mecanismos para ativação de TGF-β te-nham sido identificados, estudos em camundongos deficientes de integrina β6 (camundongos nulos de β6) sugerem que a ativação mediada por ονβ6 de TGF-β é necessária para o desenvolvimento de fibrose no pulmão e rim [18,26]. ανββ é expressa em níveis baixos ou não detectáveis nos tecidos adultos normais, mas é fortemente supra-regulada na doença inflamató-ria/f ibrótica e é geralmente restrita às células epiteliais [27-30]. Assim, a expressão supra-regulada de θνβ6 em células epiteliais durante a lesão tecidual proporciona um mecanismo aumentado para ativação local aumentada de TGF-β e subsequentes eventos dependentes de TGF-β em células bystan-der. O bloqueio da ligação do ligante θνβε [31] proporciona um método para inibição localizada da ativação de TGF-β especificamente nos tecidos, onde há expressão supra-regulada de Ονββ- Essa abordagem oferece o potencial para reduzir os riscos na segurança clínica associados à inibição global da por meio de de TGF-β.
Nos estudos descritos aqui, foi mostrado que θνββ é significantemente supra-regulada nas doenças pulmonares humanas associadas à patologia inflamatória e fibrótica, incluindo fibrose pulmonar idiopática (IPF). Estudos prévios têm demonstrado que camundongos nulos de β6, que carecem da função de Ονβε são protegidos da fibrose pulmonar induzida por ble-omicina [18]. Foi mostrado aqui que anticorpos monoclonais que bloqueiam a ligação de ligante e funções de ativação de TGF-β inibem potencialmente a fibrose induzida por bleomicina, em uma variedade de cepas de camun-dongo e por um número de medidas diferentes da fibrose. Foi demonstrado ainda que as populações de células alveolares não são alteradas em doses eficazes baixas no pulmão lesionado por bleomicina e assim o mecanismo de ação anti-fibrótica é, como esperado, não mediado por inibição de inflamação. Somente com dosagem frequente alta tem a inflamação adicional sido vista neste modelo, consistente com o achado de inflamação adicional em camundongos nulos de β6.
MATERIAIS E MÉTODOS
1. Reagentes. Ονββ mAbs foram gerados conforme descrição em algum lugar aqui e como previamente descrito [31]. cDNAs de 2A1 e 3G9 quiméricos humanos/camundongo foram gerados do RNAs totais de hibro-doma parentes com iniciadores de região constante CDL-739 para a cadeia pesada e CDL-738 para a cadeia leve usando o kit de síntese de cDNA do Primeiro Filamento (Amersham/Pharmacia, Piscataway, NJ. Os genes de regiões variáveis das cadeias leve e pesada foram amplificados pela reação em cadeia de polimerase usando os mesmos iniciadores 3' empregados para a síntese de cDNA e pool de iniciadores degenerados específicos para a maioria das sequências de sinais de gene de anticorpo murino (sequências disponíveis mediante solicitação) e Pfu DNA polimerase (Stratagene, La Jol-la, CA). Regiões variáveis de cadeias pesada e leve clonadas foram ligadas em vetores de expressão de mamífero com regiões constantes de lgG1 humano. Proteína de fusão de receptor de TGF-β tipo II murino-lg (rsTGF^rll-Ig) foi gerada como previamente descrito [32]. mu3G9 grau de pesquisa, 1 E6 e rsTGF- rll-lg (proteína purificada em solução salina tamponada com fosfato) foram usadas em todos os experimentos.
2. Animais
Camundongos. Camundongos SV129 foram usados para experimentos com hidroxiprolina do pulmão como ponto final (Sheppard Labora- tory, UCSF). Os camundongos C57B16 foram usados para experimentos com histomorfometria ou coleta e análise do BAL como pontos finais, camundongos de repórter transgênicos foram usados (Biogen Idec). Para análise quantitativa de expressão de gene de colágeno como um ponto final, os camundongos repórter transgênicos foram usados (Biogen Idec). Os camundongos transgênicos transportando um gene repórter de luciferase sob o controle de uma região 17 kB do promotor do gene coM Ia foram previamente descritos [33]. Esses camundongos são mantidos por criação de machos transgênicos para fêmeas híbridas C57B1/6 XDBA/2 F1 (Jackson Laboratories). Progénie positiva para o transgene (avaliado por expressão de luciferase na cauda) foi selecionada para os experimentos de desafio com bleo-micina descritos abaixo.
Hamsters (Giri Laboratorv). Hamsters Dourado da Síria, machos, pesando de 90 a 110 g foram adquiridos da Simonsens, Inc. (Gilroy, CA). Os hamsters foram alojados em grupos de 4, em instalações com ar filtrado e temperatura e umidade constantes. Todo o cuidado estava de acordo com o National Institutes of Health Guide for Animal Welfare Act. Os hamsters foram aclimatizados nas instalações por 1 semana, antes de quaisquer tratamentos. Um ciclo de 12 horas de calor/escuro foi mantido.
3. Imunoistoquímica. Pulmões de camundongos foram coletados em formalina tamponada a 10% e processado para histologia em parafina de acordo com práticas comuns. Seções de tecidos em parafina de pulmões de pacientes com doença pulmonar com patologia fibrótica foram obtidas de G. Davis (U Vermont), P». Lafyatis (Boston University), Ardais Corp. (Lexington, MA) e Asterand Inc. (Detroit, Ml). Seções de tecidos foram desparafinizadas em xileno e etanol, reidratadas em água destilada, e então imersas em metanol contendo 0,45% de H2O. Os tecidos foram incubados com pepsina (SP-2001 ; Vector Laboratories, Burlingame, CA) e bloqueados com avidina e biotina (SP-2001 ; Vector Laboratories, Burlingame, CA). Anticorpo primário foi diluído em PBS contendo 0,1 % de BSA e os tecidos foram incubados durante a noite a 4°C. As seções foram incubadas com uma forma quimérica/camundongo do mAb anti-avP6, 2A1 [31], e um anticorpo secundário bioti- nilado antihumano (PK-6103, Vector Laboratories, Burlingame, CA) para tecidos de camundongo.
As seções foram incubadas com 2A1 murino [31], e um anticorpo secundário biotinilado anticamundongo (PK-6102, Vector Laboratories) para tecidos humanos. Complexo de avidina-biotina-raiz forte peroxidase (Vetor Kit, PK-6102) foi aplicada às seções, incubadas por 30 minutos à temperatura ambiente, e substrato de 3,3'-diaminobenzidina (DAB) foi preparada conforme instruções (SK-4100, Vector Laboratories) e aplicado às seções por 5 minutos, à temperatura ambiente. Seções dos tecidos foram coloridas com Hematoxilina de Mayer por 1 minuto e enxaguadas em água e PBS. Todas as amostras de tecidos humanos foram obtidas sob aprovação da revisão institucional local e aprovação do paciente.
3.1 Instilação de Bleomicina em Camundongos.
Cepa SV129 (D. Sheppard, UCSF). Os camundongos foram instilados com bleomicina ou solução salina na traquéia, conforme descrição prévia [18]. Resumindo, camundongos de 8 a 12 semanas emparelhados com sexo e idade da linhagem 129/terSVEMS foram mantidos em um ambiente isento de patógeno específico. Bleomicina (Mead Jonhson, Princenton, NJ) foi dissolvida em solução salina estéril (0,03 ou 0,05 unidades em 60 ml). Bleomicina ou solução salina foi administrada transtraquealmente sob anestesia com metoxiflurano por direta redução.
Camundongos da cepa C57B1/6 e Repórter de Colágeno (Bio-gen IDEC). OS camundongos foram anestesiados por injeção IP com 100 mg/kg de cetamina e 100 mg/kg de xilazina. Uma incisão de 0,5 - 1 ,0 cm foi feita no pescoço usando um bisturi n2 15 para expor a traquéia à visualização. Bleomicina foi instilada com um dispositivo de microaspersão Penn Century expondo a traquéia e colocando a ponta do microaspersor na tra- quéia através da cavidade oral. A solução salina foi instilada em animais de controle. Depois da instilação, o sítio cirúrgico foi fechado com grampos estéreis para ferimentos. Buprenorfina, 0,05 mg/kg, foi administrada subcuta- neamente para dor pós-operatória.
Protocolos de tratamentos múltiplos foram utilizados para avaliar o artigo de teste nesses estudos com bleomicina em camundongos e serão, portanto, descritos na seção de resultados.
3.2. Instilação de Bleomicina em Hamster. Sob anestesia pento- barbital, os hamsters foram instilados IT com solução salina (AS; 4 mL/kg) ou bleomicina (BL: 6,5 U/4 mL/kg) nos dias 0, 7 e 14. Os animais foram aleatoriamente divididos em seis grupos experimentais: instilados com SA, tratados com PBS (SA + PBS); instilados com BL, tratados com PBS (BL + PBS);; instilados com BL, tratados com mu3G9 começando no dia 0 (BL + Ab1 ); instilados com BL, tratados com mu3G9 começando no dia 7 (BL + Ab2); instilados com BL, tratados com mu3G9 começando no dia 14 (BL + Ab3); e instilados com BL, tratados com 1 E6 começando no dia 0 (BL + 1 E6). Os animais foram sacrificados no dia 28 e seus pulmões foram removidos e processados para ensaios de hidroxiprolina e peroxidação lipídica.
4. Ensaio de Hidroxiprolina para Teor de Colágeno. Os pulmões foram homogeneizados em 1 mL de dH2O em tubos de vidro (Fisher N2 14961 ). 125 μί de ácido tricloroacético (TCA) a 50% foram adicionados ao homogeneizado e incubados em gelo por 20 minutos. As amostras foram centrifugadas a .000 rpm, 5 minutos, e a 4°C. O sobrenadante foi descartado e HCI 12N foi adicionado ao precipitado no tubo de vidro. As amostras foram cozidas a 110°C, por 24 horas (em um béquer de vidro). O precipitado seco foi reconstituído com 2 ml de dH2O. Seis padrões de hidroxiprolina (Sigma -H6002) foram feitos começando de 0,25 mg/mL. Em um tubo Ep-pendorf, 1 ,5 mL, contendo 500 μΙ de cloramina T (cloramina T a 1 ,4% em Acetato de sódio 0,5M e isopropanol a 10%), 200 μί da amostra foram adicionados e incubados 20 minutos à temperatura ambiente. Então, 500 μί de Ehrlich/pDMBA (p-DMBA 1 M (p-dimetilaminobenzaldeído) em isopropanol a 70% e ácido perclórico) foram adicionados e incubados a 65°C por 15 minu- tos. 100 μί. da solução de reação final foram transferidos para uma placa de 96 cavidades, medição em triplicata foi realizada para cada amostra, e as amostras foram lidas em 550 nm, 2 horas mais tarde.
5. índice de Histologia. Para experimentos com histomorfometria como um ponto final, na ocasião do sacrifício o pulmão inteiro de cada camundongo foi avaliado histologicamente. As seções transversais foram cortadas e coloridas com Tricromo de Masson por rotina padrão. Seções transversais foram escolhidas de modo a incluir múltiplos lobos dos pulmões de cada camundongo. Campos de alto poder (100X) foram fotografados para cobrir toda a seção colorida com tricromo (uma média de cerca de trinta por camundongo). Cada foto foi avaliada quanto ao teor de colágeno (que aparece azul nas seções histológicas coloridas com tricromo) pelo software Me-tamorph 6.0.5. As áreas azuis foram selecionadas por limite de cor, e expressas como percentagem da área tecidual total.
6. Ensaio com Luciferase. Os pulmões foram coletados e homogeneizados em 1 ml_ de tampão de lise (KH2PO4 0,1 M, pH 7,8 e DL-ditio-treitol 1 ml). As amostras foram então colocadas no gelo por 10 minutos, centrifugadas a 12.000 rpm por 10 minutos, a 4°C, e então 100 μΙ_ de cada amostra foi transferida para um Wallac Isoplatter. As amostras foram novamente colocadas em gelo por 15 minutos antes de adicionar 100 μΙ_ de Substrato Luclite (PerkinElmer Ne 601911). A atividade da luciferase foi então lida em um luminômetro.
7. Coleta Broncoalveolar (BAL) e Coloração das Células de BAL. Os camundongos foram eutanizados com uma overdose de injeção perito-neal (IP) de Inactina (Sigma). A traquéia foi exposta usando principalmente dissecação de cego, A traquéia foi então aberta com tesouras entre dois a-néis de cartilagem e uma agulha de ponta cega de calibre 23 foi inserida na traquéia. A agulha foi mantida no lugar por grampeamento leve com um grampo temporário de Schwartz (Roboz). BAL foi realizado por injeção de 0,8 ml_ de solução salina tamponada com fosfato sem Ca2+ ou Mg2 (PBS) nos pulmões. O fluído foi então retraído na seringa, sem aplicar muita pressão, e transferido para um tubo Falcon, de polipropileno, 15 ml_, no gelo. O procedimento foi repetido, o fluido de BAL foi sugado de volta para a seringa sem exercer excesso de pressão negativa. As amostras foram armazenadas em gelo e processadas para contagens de células, diferenciais e tanto o precipitado como o fluido do BAL foram coletados e armazenados a -80°C.
1. O Bal foi então girado a 180g, 1.000 rpm (Beckman GPR) por

10 minutos em uma centrífuga de mesa a 4°C. O sobrenadante (fluido de BAL) foi então removido e congelado a -80°C. 1 ,0 mL de solução de lise RBC (Sigma) foi adicionado ao precipitado e turbilhonado por 20 segundos. As contagens de células e cistospinas foram então efetuadas.
2. As amostras foram armazenadas em gelo e contadas usando um hemocitômetro, deixando as células sedimentarem por um minuto depois das células serem aplicadas ao hemocitômetro e antes da leitura.
3. 100 μL· de suspensões celulares foram citogiradas (Thermo-Shandon) a 500 rpm, por 5 minutos, à temperatura ambiente. Preparações de citospina foram preparadas colocando-se a solução celular no aparelho citogiratório e girando a 500 rpm por 5 minutos. As concentrações de células foram verificadas para se certificar que as concentrações não eram muito altas na lâmina. As lâminas foram deixadas secar durante a noite e então coloridas com DiffQuik (Fisher). A coloração foi efetuada de acordo com o protocolo do fabricante (DiffQuik). Uma vez que as lâminas foram secadas e a tampa introduzida por deslizamento com Permount (Fisher), as células foram categorizadas por tipo, contando 100 células selecionadas aleatoriamente usando um contador de células de laboratório (Fisher).
8. Análise Estatística. Comparações estatísticas foram feitas en-tre o controle e/ou controle de isótipo, e o artigo de teste usando análise de variância (ANOVA). Quando diferenças estatisticamente significantes foram estabelecidas em uma probabilidade de p<0,05, usando ANOVA, diferenças significantes entre os grupos foram avaliadas por teste de comparações múltiplas de Dunnet.
RESULTADOS
1. Expressão de ανββ humana em doença pulmonar humana e no modelo de bleomicina. Expressão supra-regulada e sinalização de TGF-β e foram descritas em várias doenças pulmonares humana, envolvendo patologia fibrótica ou inflamatória [20, 34]. Contudo, a expressão de anti-o 6 foi somente descrita em uma pequena amostra de doença pulmonar fibro- inflamatória [28]. A expressão de θνβ6 fi avaliada em quarenta e uma amostras de tecidos pulmonares de pacientes com doença pulmonar caracterizada como tendo alterações fibróticas e/ou inflamatórias (Tabela 16-1). Além disso, foi colorida uma série de tecidos pulmonares de regiões ostensivamente normais de biópsias de pulmão de pacientes com câncer (Imgenex). A expressão de Ονββ em pulmão normal era quase não-detectável por imu-noistoguímica. Algumas seções de tecido na série de tecidos de pulmão "normal" mostraram coloração positiva para ανββ. Em todas as 41 amostras de pulmões doentes, regiões de pulmão com fibrose e/ou alterações inflamatórias mostraram forte supra-regulação de expressão de ανββ (figura 58). θνβ6 foi localizada nas células epiteliais subjacentes a regiões de fibrose manifesta e em regiões adjacentes aos infiltrados inflamatórios. A presença de ανββ supra-regulada foi vista através de um espectro de doença fibroin-flamatória, incluindo fibrose pulmonar idiopática, doença pulmonar na escle-rodermia, e doença pulmonar obstrutiva crónica.
Para mais bem correlacionar a expressão com as alterações patológicas específicas, foram enviadas as amostras de tecidos coloridos para um patologista pulmonar, treinado, externo. Embora ele fosse incapaz de verificar o diagnóstico patológico de muitas das amostras comercialmente obtidas (Ardais e Asterand), ele notou consistentemente que "intensidade muito alta de coloração de ο βε foi vista com pneumonite intersticial usual", uma patologia associada à fibrose e à doença progressiva, em comparação com pneumonite intersticial não-específica (NSIP), uma patologia associada à fibrose menor e um prognóstico melhor. Em todas as biópsias dos pacientes com UIP, intensa coloração é vista dentro dos pneumócitos que revestem os duetos alveolares e alvéolos, tanto do Tipo II como do Tipo I, embora vias áreas grandes sejam altamente negativas e os macrófagos intra-alveolares sejam negativos. Em resumo, "alto nível de coloração foi associado às áreas fibróticas e UIP", e padrões similares de menor intensidade de coloração foram vistas nos outros casos de fibrose, incluindo NSIP. Já que UIP é a patologia dominante em pacientes com fibrose pulmonar idiopática (IPF), a intensa superexpressão de ανββ. um ativador da citocina TGF-β pró- fibrótica, em pacientes com esta patologia sugere que possa ter um papel funcional em acionar a progressão de fibrose.
2. Expressão de ανββ no modelo de camundongo de bleomicina. Para verificar que ανββ foi também supra-regulada no modelo de camundongo de bleomicina de fibrose pulmonar, colorimos para verificar a presença de proteína ανββ nas seções de tecido tiradas 1 , 5 e 15 dias depois de instilação de bleomicina. No dia 5, a expressão de αν ε é. supra-regulada no epitélio alveolar por todas as regiões do pulmão lesionado por desafio por bleomicina (figura 59). No dia 15, quando as regiões de fibrose proeminente são evidentes, Ονβε é mais fortemente supra-regulada no epitélio alveolar nestas áreas fibróticas.
3. Avaliação de fibrose por hidroxiprolina em camundongos SV129. Camundongos geneticamente deficientes de Ονββ (nulo de β6) demonstraram previamente proteção contra fibrose pulmonar induzida por bleomicina na linhagem SV129 [18]. Procurou-se avaliar a eficácia do anticorpo monoclonal anti-a^6, mu3G9, em atenuar a fibrose induzida por bleomicina na mesma cepa. Uma série de quatro experimentos foi conduzida nos laboratórios desses colaboradores, Dean Sheppard em UCSF (Tabela 16-2). Os camundongos SV129 foram instilados com bleomicina na traquéia no dia 0, e mu3G9 foi injetado IP em 4 mg/kg, três vezes por semana, começando em 0, 15 ou 30 dias depois da instilação de bleomicina. Camundongos de controle foram injetados com PBS, ou com um anticorpo de controle negativo 1 E6. O 1 E6 é um anticorpo lgG1 murino contra LFA-3 humano, e não se liga a nenhum antígeno de camundongo. Os camundongos foram sacrificados no dia 30 ou 60, e a fibrose foi avaliada pelo teor de hidroxiprolina de colágeno tecidual total. Em três dos quatro experimentos houve um decréscimo estatisticamente significante de hidroxiprolina nos camundongos tratados com mu3G9, indicativo da eficácia em atenuar a fibrose induzida por bleomicina (figura 60). Somente quando o tratamento foi retardado até 30 dias depois da instilação com bleomicina (figura 60C) é que o teor de hidroxiproiina nos pulmões de camundongos tratados com mu3G9 não decresceu significativamente em comparação com os camundongos tratados com PBS ou tratados de controle de isótipo.
4. Avaliação da sobrevivência em camundongos tratados 46 dias e desafiados com bleomicina. A eficácia anti-fibrótica no modelo de bleomicina não se correlaciona diretamente com sobrevivência aperfeiçoada, e, portanto, não se espera que a sobrevivência fosse aperfeiçoada nos camundongos tratados com mu3G9. Contudo, já que esses camundongos tratados com mu3G9 em 4 mg/kg, 3 vezes na semana a partir do dia 15 até o dia 60 (figura 60D) representaram o período mais longo de tratamento (46 dias) que havia sido testado até esse ponto, analisamos para ver se havia qualquer diferença na sobrevivência dos grupos testados naquele experimento. Não houve diferença significante na sobrevivência global quando foram comparados os camundongos tratados com mu3G9 com aqueles tratados com PBS e com anticorpo de controle de não bloqueio 4B4 (Tabela 16-2).
5. Análise histomorfométrica de fibrose em camundongos C57B16. Para validar a eficácia antifibrótica de mu3G9 em uma diferente linhagem de camundongo e em um laboratório diferente, mu3G9 foi avaliado em uma série de experimentos na Biogen Idec usando a linhagem de camundongo C57B16. Essa linhagem é frequentemente usada no modelo de bleomicina e dá uma rápida fibrose que pode ser medida 14 dias depois da instilação. No primeiro três experimentos, os camundongos foram instilados com bleomicina na traquéia no dia 0, tratados com mu3G9 três dias por semana, começando um dia antes do desafio com bleomicina (dia-1), e eutanizados no dia 14 para coleta de pulmões. No quarto experimento, o tratamento foi retardado até o dia 14, e os pulmões foram coletados no dia 28. Em cada um desses experimentos (figura 61 ), mu3G9 decresceu consistentemente a percentagem de tecido pulmonar fibrótico com relação aos controles tratados com PBS,_ medida _h.isto_mo_rfom.etricame.nte como regiões de coloração azul nas seções de tecidos coloridas com tricromo de Masson. Em um de dois experimentos, no qual o mAb 1 E6 foi usado como controle negativo de IG, o mAb 1 E6 também reduziu significantemente a percentagem de tecido fibrótico (figura 61 A). Esse efeito do mAb 1 E6 não foi visto nos experimentos anteriores usando hidroxiprolina como o ponto final (figura 60), nem no experimento de tratamento retardado (dias 14 a 28) (figura 61 D). Em resumo, experimentos múltiplos demonstrando a eficácia do mAb mu3G9 na redução da percentagem de tecido fibrótico induzido por bleomicina em camundongos C57B16. Contudo, devido à natureza de intensivo trabalho do ponto final de histomorfometria, procuramos um método mais rápido e quantitativo para medir fibrose.
6. Uso de transgene repórter de colágeno-luciferase como um ponto final. Camundongos transgênicos transportando um transgene no qual o gene repórter da luciferase é expresso sob controle do promotor de colágeno Ia2 têm sido usados anteriormente para proporcionar uma leitura quantitativa da expressão de colágeno nos modelos de fibrose [33]; [35]. Nos 14 dias, o aumento dos níveis de luciferase no pulmão nos camundongos desafiados por bleomicina com relação aos controles de solução salina foi de a-proximadamente 10 vezes, fazendo com que este fosse um ponto final muito mais sensível que a medição de hidroxiprolina. Usando esse sistema, foi realizada uma titulação da dose do anticorpo 3G9 usando dosagem de uma vez por semana, mas incluindo um grupo de camundongos que foi tratado com os 4 mg/kg - o regime de dosagem de três vezes por semana usado nos experimentos com hidroxiprolina e histomorfometria de tricromo como o ponto final. A titulação da dose foi avaliada em três experimentos, nos quais cada experimento tinha um grupo de controle tratado com PBS (n=6, 5 e 6, para um total de n=17). Para corrigir a variação de experimento para experimento em medições de luciferase, os valores de luciferase para todos os grupos em cada experimento foram normalizados para a média dos controles de PBS. O tratamento com mu3G9 dos camundongos repórter desafiados com bleomicina produziu uma redução dependente de dose no repórter de colágeno luciferase (figura 62), com eficácia significante vista em uma . dose semanal de 0,3 mg/kg e eficácia máxima vista em 1 a 3 mg/kg.
7. Análise da composição de células do lavagem broncoalveolar.

Analisamos as populações de células no lavagem broncoalveolar (BAL) nos dias 2, 5, 8 e 11 do modelo de bleomicina para determinar se a inibição de fibrose era devido à inflamação reduzida ou alterações nas principais subpo- pulações das células inflamatórias no pulmão. Como esperado, ocorreram elevações das contagens de células no BAL devido à administração intratra- queal de bleomicina em comparação com camundongos instilados com solução salina. Contudo, durante todo o período de tempo, não houve diferença significante no número total de células do BAL, nem nos números ou percentagens dos macrofagos, neutrófilos ou linfocitos vistos nos camundongos tratados com as doses eficazes de 0,3 1 ,0, e 3 mg/kg de 3G9 em comparação com camundongos tratados com um anticorpo de controle de isótipo 1 E6. Testamos, então, doses muito mais altas, usando o tratamento de três vezes por semana que havia sido usado inicialmente para demonstrar a eficácia com os pontos finais de hidroxiprolina e histomorfometria. Aos camundongos foram dadas três doses de 4, 20 e 40 mg/kg de m3G9 nos dias -1 , +1 e +3 com relação ao desafio com bleomicina. Os camundongos foram eutanizados no dia 5 e o teor de células do BAL foi analisado. Em uma dose de 4 mg/kg (12 mg/kg de dose total), de novo não ocorreu nenhuma alteração significante no números de células do BAL, nem nos números ou percentagens dos macrofagos, neutrófilos ou linfocitos. Em 20 e 40 mg/kg de dose (60 e 120 mg/kg no total), houve um aumento significante no número de macrofagos em relação aos controles de PBS, mas não em relação ao controle de lgG1 (figura 62). Na dose de 40 mg/kg, houve um aumento significante da percentagem de neutrófilos no BAL, quando em comparação com ambos os controles de PBS e IgG, embora as alterações no número total de neutrófilos não tenham atingido significância. Esse aumento de neutrófilos que ocorre em dose muito alta (120 mg/kg no total) é similar àquele visto com o tratamento de dose alta e prazo mais longo (6 e 10 mg/kg de tratamento, 3-4 meses) em modelo de fibrose por radiação (vide Exemplo 15). Em resumo, anticorpos anti-OvP6 são capazes de atenuar expressão de co-_ lágeno induzida por bleomicina em dose semanais tão baixas quanto 0,3 mg/kg, enquanto doses até 12 mg/kg no total não produzem alterações signi- ficantes nas populações de células do BAL neste modelo. Doses mais altas podem produzir aumentos no número total de macrófagos e na percentagem de neutrófilos.
8. Avaliação em uma modelo de hamster com doses múltiplas de bleomicina. Foi examinada a eficácia do mu3G9 em modelo de hamster de fibrose pulmonar, onde três doses consecutivas de bleomicina são dadas intratraquealmente nos dias 0, 7 e 14. Três grupos de hamsters foram tratados com mu3G9 em 5 mg/kg por três vezes na semana (15 mg/kg no total por semana), começando nos dias 0, 7 ou 14. Os animais foram sacrificados e avaliados quanto à fibrose no dia 28 por hidroxiprolina (figura 65A) e ensaios de peroxidação lipídica (figura 65B) (realizados na U. Califórnia-Davis, Davis, CA). Inesperadamente, a eficácia não foi vista na atenuação de fibrose neste modelo. Em um dos grupos, os hamsters tratados com mu3G9 começando no dia 7 e no dia 14, os camundongos mostraram uma aumento estatisticamente significante da hidroxiprolina no pulmão com relação a ambos os grupos de controle de PBS e IgG. Os valores de peroxidação lipídica não foram significativamente elevados. As curvas de sobrevivência dos vários grupos de tratamento foram analisadas para ver se esta exacerbação aparente estava tendo um efeito na sobrevivência dos hamsters. Os camundongos tratados com mu3G9 começando no dia 0 (grupo BL + AB1 na figura 65C) começaram a morrer ligeiramente mais cedo que os de controles de PBS e IgG; contudo, quando em comparação com a curva de sobrevivência de B1 + Ab1 individualmente contra os controles de PBS e IgG, a diferença não foi significante (teste de log-rank: p=0,5 versus PBS e p=0,25 versus mAb de controle de IgG). Não é sabido se o anticorpo monoclonal mu3G9 reage em ligação cruzada com o hamster, e é possível que os hamsters possam ter gerado uma resposta a anticorpo contra os anticorpos murinos usados neste modelo. Devido às dificuldades em interpretar os resultados neste modelo, a avaliação de doses diferentes para eficácia não perseguidas, já que_ eficácia consistente fpLPbseryada em dois diferente modelos murinos de fibrose pulmonar (induzida por bleomicina e por radiação).

Tabelas
Tabela 16-1 : Amostras de Doenças Pulmonares Humanas Imunocoloridas para Expressão de ο ββ

Patologia/Diagnóstico (se disponível) Número de
Casos
Doença pulmonar intersticial difusa 1
Massa Inflamatória 1
Sarcoidose 1
Inflamação crónica e fibrose (IPF) 1
Inflamação focal 2 Dr. Gerald Davis

Doença pulmonar intersticial 1 University of Vermont de bronqueolite respiratória
Brohquiectasia 1
Enfisema, pneumonia focal 1
Fibrose intersticial difusa com enfisema 1
Fibrose de efeito de radiação 3
Fibrose 4
Fibrose cística 1
Doença pulmonar obstrutiva crónica Ardais Corp.

Bronquite crónica 2
Bronquiecstasia 1
Pneumonia/fibrose, não específica, 1
intersticial (NSIP-F)
Fibrose 2 Asterand Inc.

Pneumonia 2
Doença pulmonar com esclerodermia 14 Dr. Robert Lafyatis.
Boston University

Total de Amostras 41 Tabela 16-2: Sobrevivência dos camundongos desafiados com Bleomicina tratados 46 dias com mu3G9



Conclusões
mu3G9 é um potente inibidor da gravidade da doença no modelo de fibrose por bleomicina. Essa série de experimentos demonstrou:
(a) expressão de Ον β é supra-regulada nas células epiteliais em um amplo espectro de doenças pulmonares humanas com patologia fibrótica e/ou inflamatória. É similarmente supra-regulada no modelo de camundongo de fibrose por bleomicina.
(b) mu3G9 reduziu significantemente a fibrose induzida por bleomicina em múltiplos experimentos, usando múltiplos pontos finais para análise. A eficácia foi observada em todas as cepas de camundongos testadas, SV129, C57B16, e híbridos C57B16 X DBA. A eficácia em suprimir a expressão de colágeno foi vista em doses tão baixas quanto 0,3 mg/kg, sema- nalmente.
(c) o mecanismo de ação de mu3G9 é por meio de inibição de - TGF-β, uma citocina pró-fibrótica com propriedades antiinflamatórias. Como esperado, a inibição de fibrose ocorre sem atenuação da inflamação. Doses altas frequentes de mu3G9 (20 e 40 mg/kg dados dia sim dia não) podem induzir modestos aumentos relativos a PBS, mas não controles de IgG em células totais do BAL, macrófagos e neutrófilos do lavagem broncoalveolar dos camundongos desafiados no dia 5.
(d) mu3G9 não foi eficaz em um modelo de bleomicina de doses múltiplas em hamster. Não é claro se a exacerbação aparente da fibrose em um grupo tratado com 3G9 era relacionada ao artigo de teste.
(e) tratamento com mu3G9 em uma dose de 4 mg/kg, 3 vezes por semana, por 46 dias, não afetou a sobrevivência no modelo de bleomicina.

REFERÊNCIAS
1. Roberts, A.B., et ai., Transforming growth factor type B: Rapid in- duction of fibrosis and angiogenesis in vivo and stimulation of collagen for- mation in vitro. Proc. Natl. Acad. Sei, USA, 1986. 83: p. 4167- 4171.
2. Roberts, A.B. and M.B. Sporn, Regulation of endothelial cell growth, architecture, and matrix synthesis by TGF-beta. Am. Rev. Respir. Dis., 1989. 140: p. 1 126-1128.
3. Varga, J., J. Rosenbloom, and S.A. Jimenez,
Transforming growth factor beta (TGF beta) causes a persistent incre-ase in steady-state amounts of type I and type III collagen and fibronectin mRNAs in normal human dermal fibroblasts. Biochem. J., 1987. 247(3): p. 597-604.
4. Grande, J.P., D.C. Melder, and A.R.
Zinsmeister, Modulation of collagen gene expression by cytokines: stimulatory effect of transforming growth factor-betal , with divergent effeets of epidermal growth factor and tumor necrosis factor-alpha on collagen type I and collagen type IV. J. Lab Clin. Med., 1997. 130(5): p. 476-486.
5. Walker, G.A., et al., Valvular myofibroblasts activation by transforming growth factor-beta: implications for pathological extracellular matrix re-modeling in heart valve disease. Circ. Res., 2004. 95(3): p. 253-260.
6. Eickelberg, O., et al., Extracellular matrix deposition by primary human lung fibroblasts in response to TGF-betal and TGF-beta3. Am. J. Physi-ol., 1999. 276(5): p. L814-L824.
7. Sime, PJ., et al., Adenovector-mediated gene transfer of active transforming growth factor-βΙ induces prolonged severe fibrosis in rat lung. J. clin. Invest., 1997. 100: p. 768-776.
8. Bonniaud, P., et al., Progressive TGF-(beta)l- induced lung fibrosis is blocked by an orally active ALK5 kinase inhibitor. Am. J. Respir. Crit. Care Med., 2004. 171 : p. 889-898.
9. Laping, NJ., ALK5 Inhibition in renal disease. Curr. Opin. Pharma-col., 2003. 3(2): p. 204-208.
10. Miyajima, A., et al., Antibody to transforming growth factor-p ameli- orates tubular apoptosis in unilateral ureteral obstruction. Kid. hit, 2000. 58: p. 2310-2313.
11. Sharma, K., et al., Neutralization of TGF-beta by an anti-TGF-beta antibody attenuates kidney hypertrophy and the enhanced extracellular matrix gene expresssion in STZ-induced diabetic mice. Diabetes, 1996. 45(4): p. 522-530.
12. Wang, Q., et al., Reduction of bleomycin induced lung fibrosis by transforming growth factor β soluble receptor in hamsters. Thorax, 1999. 54: p. 805-812.
13. Bonniaud, P., et .al., Smad3 null mice develop airspace enlarge-ment and are resistant to TGF-beta-mediated pulmonary fibrosis. J. Immunol, 2004. 173(3): p. 2099-2108.
14. George, J., et al., In vivo inhibition of rat stellate cell activation by soluble transforming growth factor type II receptor: A potential new therapy for hepatic fibrosis. Proc. Natl. Acad. Sei, USA, 1999. 96(22): p. 12719-12724.
15. Zheng, H., et al., Recombinant soluble transforming growth factor β type II receptor ameliorates radiation enterophay in mice. Gastroentero-logy, 2000. 1 19: p. 1286-1296.
16. Kasuga, H., et al., Effects of anti-TGF-β type II receptor antibody on experimental glomerulonephritis. Kid. hit., 2001. 60: p. 1745-1755.
17. Ziyadeh, F.N., et al., Long-term prevention of renal insufficiency, excess matrix gene expression, and glomerular mesangial matrix expansion by treatment with monoclonal antitransforming growth factor-β antibody in db/db diabetic mice. Proc. Natl. Acad. Sei, USA, 2000. 97(14): p. 8015-8020.

18. Munger, J.S., et al., The integrin ανβ6 binds and activates latent ΤβΡβΙ : a mechanism for regulating pulmonary inflammation and fibrosis. Celi, 1999. 96: p. 319-328.
19. Gleizes, P.E., et al., TGF-beta latency: biological significance and mechanisms of activation. Stern Celis, 1997. 15(3): p. 190-197.
20. Khalil, N., TGF-heta: from latent to active. Microbes Infect, 1999. 1 (15): p. 1255-1263.

21. Barcellos-Hoff, M.H., Latency and activation in the control of TGF- β. J. Mamm. Gland Biol., 1996. 1 (4): p. 353-363.
22. Huang, X.Z., et al., The integrin ανΒ6 is criticai for keratinocyte migration on both its known ligand, fibronectin, and on vitronectin. J. Celi Sei., 1998. Ill: p. 2189-2195.
23. Busk, M., R. Pytella, and D. Sheppard, Characterization of the integrin alpha v beta 6 as a fibronectin-binding protein. J. Biol. Chem., 1992. 267(9): p. 5790-5796.
24. Yokosaki, Y., et al., Differential effeets of the integrins alpha9betal, alphavbeta3, and alphavbeta6 on cell proliferative responses to tenascin. Roles of the beta subunit extracellular and cytoplasmic domains. J. Biol. Chem., 1996. 271 (39): p. 24144-24150.
25. Annes, J.P., D.B: Rifkin, and J.S. Munger, The integrin ανβ6 binds and activates latent TGFp3. FEBS lett, 2002. 511 : p. 65- 68.
26. Ma, LJ., et al., Transforming growth factor-β- dependent and inde-pendent pathways of induction of tubulointerstitial fibrosis in β6-/- mice. Am. J. Pathol., 2003. 163: p. 1261-1273.
27. Breuss, J.M., et al., Restricted distribution of integrin β6 mRNA in primate epithelial tissues. J. Histochem. and Cytochem., 1993. 41 (10): p. 1521 -1527.
28. Breuss, J.M., etal., Expression of the R6 subunit in development, neoplasia and tissue repair suggests a role in epithelial remodeling. J. Cell Sei., 1995. 108: p. 2241 -2251.
29. Zambruno, G., et al., Transforming growth factor-βΙ modulates βΙ and β5 integrin receptors and induces the de novo expression of the avB6 heterodimer in normal human keratinoeytes: implications for wound healing. J. Cell Biol, 1995. 129(3): p. 853-865.
30. Hakkinen, L, et al., Increased expression of β6- integrin in skin le-ads to spontaneous development of chronic wounds. Am. J. Pathol., 2004. 164: p. 229-242.
31. Weinreb, P.H., et al., Function-blocking integrin alphavbeta6 mo-noclonal antibodies. J. Biol. Chem., 2004. 279(17): p. 17875-17887.

32. Cosgrove, D., et al., Integrin αΙβΙ and transforming growth factor-βΙ play distinct roles in alport glomerular pathogenesis and serve as dual targets for metabolic therapy. Amer. J. of Pathol, 2000. 157(5): p. 1649-1659.
33. Inagaki, Y., et al., Activation of Proalpha2(l) collagen promoter du-ring hepatic fibrogenesis in transgenic mice. Biochem Biophys Res Commun,

1998. 250(3): p. 606-11.
34. Broekelmann, T.J., et al., Transforming growth factor βΙ is present at sites of extracellular matrix gene expression in human pulmonary fibrosis. Proc. Natl. Acad. Sei, USA, 1991. 88: p. 6642-6646.
35. Denton, C.P., et al., Activation.of a fibroblast- specific enhancer of the proalpha2(l) collagen gene in tight-skin mice. Arthritis Rheum, 2001.

44(3): p. 712-22.
GLOSSÁRIO

1 E6 Anticorpo monoclonal murino lgG1 contra o LFA-3 humano.
Não se liga a antígeno de camundongo
Esse é usado como um mAb de controle de lgG1
ANOVA análise de variância
Nulo de 6 camundongos deficientes da subunidade de integrina β6
Esses camundongos são deficientes somente de integrina

BAL Lavagem broncoalveolar
BALF Fluido do lavagem branco alveolar
lq Imunoglobulina
IP Intraperitoneal
mAb Anticorpo monoclonal
mu3G9 ou 3G9 Anticorpo monoclonal murino lgG1 contra integrina θνβ6
Esse é a forma parente de BG00011 , antes da
humanização.
sTGF-bR ou Receptor de TGF-β Tipo I, solúvel, fundido ao domínio sTGFbRII-lg de lq
TGF-β Fator beta de crescimento transformante APÊNDICE A: Variação da dosagem de mu3G9 (hidroxiprolina)




Dias 15-60 PBS 4B4 3G9 8G6

Bleomicina Média 208,45 178,17 160,3 134,49
desvio padrão 19,36 22,4 15,25 6,29
n 7 10 11 8

Solução Salina Média 104,54 115,98 111 ,98 110,9
desvio padrão 15,13 7,26 9,5 12,44
n 5 5 5 5

APÊNDICE C: Variação da Dosagem de mu3G9 (camundongos repórter de colágeno)

0.1 0.3 1 3X4 sTGFbRU - PBS Mg/kg Mg/kg Mg/kg 3 Mg/kg 10 mg/kg Mg/kg i g Sham

Média 3617 2887 2021 1121 837 1274 1927 768 331

Desvio Padrão
1768 1819 723 1023 500 872 1456 286 166 n 17 11 12 15 6 5 5 5 3

(Essa página foi deixada intencionalmente em branco)

APÊNDICE: Çomposição do BAL em Bleo: dosagem semanal
Sem Bleo PBS 0.3 mg/kg
média desvio padrão n média desvio padrão n média desvio padrão n

Dia 2 1 ,40 0,45 5 2,80 0,75 10 4,83 1 ,32 10

BAL total Dia 5 2,51 0,87 5 8,80 6,17 10 7,35 4,97 10

Dia 8 2,70 0,69 5 10,83 6,59 8 7,39 2,21 9

Dia 11 2,26 0,55 5 12,17 2,13 9 7,73 2,33 8

macrófago Dia 2 1 ,33 0,39 3 2,33 0,54 9 4,22 1 ,20 9

Dia 5 2,51 0,87 5 6,65 4,26 10 i 5,34 3,98 10

Dia 8 1 ,85 0,49 5 9,86 5,57 10 8,23 4,22 9

Dia 11 2,26 0,55 5 8,50 2,15 8 2,83 2,40 7

Dia 2 0 0 3 0 0 9 0 0 9 linfócito Dia 5 0 0 5 0 0 10 0 0 10

Dia 8 0 0 5 0,78 0,98 10 0,16 0,19 9

Dia 11 0 0 5 0,27 0,23 8 0,05 0,07 7

Neutrófilo Dia 2 0,002 0,008 3 0,42 0,47 9 0,92 0,56 9

Dia 5 0 0 5 2,15 3,43 10 2,01 1 ,77 10

Dia 8 0 0 5 1 ,33 1 ,21 10 3,13 2,12 9

Dia 11 0 0 4 3,31 2,44 8 3,22 2,50 6

APÊNDICE E: Composição Celular no BAL: Dosagem de Três Vezes por Semana

Mu3G9 1E6
média No Bleo PBS 4 mg/kg 20 mg/kg 40 mg/kg 20 mg/kg 40 mg/kg
Média 3,38 15,37 20,26 22,36 24,03 8,69 18,10 desvio padrão 1,68 9,27 12,17 7,10 17,06 5,42 9,12

BAL total N 12 10 15 16 7 6 5

Mean 3,24 9,10 12,70 14,69 10,76 6,26 12,25

Macrófago desvio padrão 1,56 4,43 6,93 5,10 6,16 3,54 3,35
N 12 10 15 16 7 6 5

Média 0,12 ' 1 ,17 1,89 1,95 0,95 0,59 0,77 linfócito desvio padrão 0,14 1,05 1,93 1,25 0,89 0,67 0,77
N 12 10 15 16 7 6 5
u
Média 0,01 5,10 5,67 5,73 12,32 1,84 5,08

Neutrófilo desvio padrão 0,02 6,74 7,00 4,72 11,64 2,51 6,35
N 12 10 15 16 7 6 5

EXEMPLO 17: Análise Molecular dos Efeitos de um Anticorpo Monoclo Antiintegrina Ονββ em Pulmão de Camundongo Normal e Doente
SUMÁRIO
Modelos de animal para fibrose pulmonar são eficazes na mo lação de alguns aspectos da patologia fibròtica de fibrose pulmonar idiop ca (IPF) humana; contudo, nenhum modelo animal mimetiza com acuidad patologia precisa de IPF. Além disso, já que os mecanismos da iniciaçã progressão de IPF não são completamente entendidos, é importante te potenciais agentes terapêuticos em múltiplos modelos da doença e avalia sua eficácia não somente em termos de atenuar a patologia fibròtica, também em termos de intervir nas vias moleculares que são tidas como levantes na doença humana. A por meio de de TGF-β tem sido implic como uma por meio de chave em IPF. A caracterização global de transcri de pulmão com IPF humano tem mostrado que a assinatura dominante n ta doença é uma de uma por meio de de TGF-β ativada, que é consiste com os papéis conhecidos do TGF-β no acionamento de muitos dos proc sos patológicos que caracterizam a fibrose pulmonar, incluindo a ativaçã proliferação de fibroblastos e a expressão de moléculas da matriz extrace lar. Além de suas atividades pró-fibróticas, TGF-β é uma importante citoci antiinflamatória, e assim a inibição terapêutica de TGF-β deve idealme bloquear a fibrose em promover excessiva inflamação. A integrina ο ββ liga diretamente aos complexos de TGF-β latente e é requerida para conv são de TGF-β em um sítio ativo. Contudo, já que a ativação de TGF-β me ada por ο βε é crítica em somente alguns tecidos, os camundongos comp tamente deficientes da função de θνβ6 mostram patologia somente no p mão, enquanto os camundongos deficientes de TGF-β mostram inflamaç em sistemas de órgãos múltiplos. Assim, a estratégia terapêutica descr aqui é bloquear a função de ανββ para evitar a inibição global da por meio de TGF-β, e demonstrar que a eficácia no bloqueio da patologia fibròtica sociada à sinalização aumentada de TGF-β pode ser obtida em doses q não induzem a inflamação associadas à perda completa de TGF-β. Aq foram caracterizadas alterações moleculares no mRNA e nível de proteí associado à patologia fibrótica e inflamatória. Foi demonstrado que altas doses do anticorpo monoclonal anti-a^, mu3G9, o parente murino do candidato clínico BG00011 , produzem alterações no mRNA e na proteína em rótulos inflamatórios no pulmão, que são consistentes com os camundongos deficientes de ανββ· Foi demonstrado ainda que baixas doses de mu3G9 que são eficazes em atenuar fibrose não produzem essas alterações inflamatórias nos camundongos.
INTRODUÇÃO
A citocina TGF-βΙ é uma citocina pró-fibrótica conhecida por estimular fibroblastos para produzir excesso de matriz extracelular (ECM), levando finalmente à formação de cicatriz e insuficiência do órgão (Roberts, 1986). Superexpressão adenoviral e transgênica de várias citocinas no pulmão mostraram que o TGF-βί é único em sua capacidade de promover fibrose na ausência de inflamação. Modelos de camundongos de nocaute de genes na por meio de de TGF-β (Bonniaud 2004, Munger 1999) e numerosos estudos com agentes anti-TGF-β têm demonstrado que a eficácia de inibição de TGF-β como meio para atenuar fibrose (George, J. 1999; Shar-ma, K. 1996; Bonnidaud, P. 2004; Zheng, H. 2000; Kasuga, H. 2001 ; Ziya-deh F. N., 2000; Laping, N.J., 2003). A integrina «νββ, composta de duas subunidades: as interinas Ov e β6, é um regulador crítico da ativação de TGF-β1 , particularmente no pulmão. Ela é supra-regulada nas células epiteliais durante lesão, inflamação e fibrose, e se liga ao complexo de TGF-βΙ , converte ndo-o em uma forma ativa. [Huang 1998; Munger 1999;Busk 1992; Yo-koaski, 1996; Annes 2002]. Bloqueio de ligação de θνβ6 ao TGF-βΙ latente proporciona um método para inibição localizada da ativação de TGF-β nos sítios de expressão supra-regulada de θνββ, evitando potenciais de riscos de segurança clínica potencial da por meio de TGF-β em todos os tecidos.
Nos Exemplos acima, caracterizamos a eficácia do anticorpo monoclonal
mu3G9, em dois modelos murinos pulmonares de fibrose foi caracterizada: fibrose induzida por bleomicina (Exemplo 16), fibrose induzida por radiação (Exemplo 15). Além disso, os efeitos do tratamento de mu3G9 em camundongos normais são descritos em detalhes nos relatórios 7

de toxicologia. Nesse Exemplo, foram caracterizados os efeitos do tratamento de mu3G9 em camundongos normais e em modelos de doença de fibrose pulmonar nos níveis de mRNA e proteína no pulmão.
A caracterização de transcritos de tecido pulmão demonstra que o bloqueio de ονββ atenua ou altera os genes alvo de TGF-β que são associados à fibrose pulmonar induzida por bleomicina. Esses dados sugerem que ο ββ está envolvida na regulação da fibrose pulmonar e poderia proporcionar um novo alvo molecular para sua modulação terapêutica.
MATERIAIS E MÉTODOS
1. Reagentes. θνβ6 mAbs foram gerados como descrito em algum lugar aqui, e como previamente descrito (29). cDNAs de 2A1 e 3G9 quiméricos, humanos/camundongo foram gerados a partir dos RNAs totais de hibridomas parentes, respectivos, com iniciadores de região constante CDL-739 para a cadeia pesada e CDL-738 para a cadeia leve usando o kit de síntese de cDNA do Primeiro Filamento (Amersham/Pharmacia, Piscata-way, NJ). Os genes de regiões variáveis de cadeias pesada e leve foram amplificados pela reação em cadeia de polimerase usando os mesmos iniciadores 3' empregados para a síntese de cDNA e pools de iniciadores degenerados específicos para a maioria das sequências de sinais de genes de anticorpo murino (sequências disponíveis mediante solicitação) e Pfu DNA polimerase (Stratagene, La Jolla, CA). Regiões variáveis das cadeias pesada e leve clonadas foram ligadas a vetores de expressão de mamífero com regiões constantes de lgG1. Proteína de fusão de receptor tipo ll-lg de TGF-β murino, recombinante, solúvel, (sTG^RII-lg) foi gerada conforme descrição prévia (10). mu3G9 de grau de pesquisa, 1 E6 e Stgf-bRII-lg (proteína purificada em solução salina tamponada com fosfato) foram usados em todos os experimentos.
2. Animais.
(a) Tratamento com mu3G9 em Camundongos Normais para Análise de RNA: os camundongos normais C57B16 foram tratados uma vez por semana, durante quatro semanas (nos dias 1 , 8, 15 e 22) com 5 mg/kg de TGFbRII-lg solúvel, PBS, ou as seguintes doses de mu3G9: 0,3, 1 , 3, 10 e 30 mg/kg. Uma coorte de camundongos tratados foi coletada no dia 29 (uma semana depois da última dose = sem recuperação), enquanto a outra coorte foi coletada no dia 78 (8 semanas depois da última dose = recuperação de 7 semanas). Esses experimentos foram realizados independentemente do trabalho descrito nos relatórios de toxicologia para camundongo mu3G9, onde a linhagem de camundongo CD-1 foi testada e foi usada uma recuperação de 8 semanas.
(b) Tratamento com mu3G9 em Camundongos Normais para Caracterização de Analisados Múltiplos de Proteínas do BAL: camundongos C57B16 normais foram tratados por 4 semanas (nos dias 1 , 8, 15 e 22) com PBS ou as seguintes doses de mu3G9: 0,1 , 0,3, 1 , 3, e 10 mg/kg. Os camundongos foram coletados no dia 29 (uma vez por semana depois da última dose) para coleta do lavagem broncoalveolar (BAL). Esses experimentos foram novamente realizados independentemente do trabalho descrito nos relatórios de toxicologia para camundongos tratados com mu3G9, onde a linhagem de camundongos CD-1 foi testada.
(c) Tratamento com mu3G9 no modelo de fibrose por radiação: Detalhes dos grupos de tratamento e os pontos finais usados na avaliação da eficácia de atenuação da fibrose induzida por radiação estão contidos no BIIB Report N- Rsch-2006-007. Em resumo, três estudos foram realizados no laboratório de John Munger no New School of Medicine onde os camundongos receberam irradiação torácica e foram tratados com doses diferentes de mu3G9 entre 0,3 e 1 ,0 mg/kg por semana, começando 15 semanas depois da irradiação. Os pulmões dos camundongos foram coletados para histologia/medição de fibrose, se encontrados mortos durante o estudo. Os camundongos sobreviventes foram coletados nas semanas 26, 28 e 32 pós-irradiação. Fluido do BAL foi coletado de um lobo de pulmão e enviado para Biogen IDEC, enquanto os outros lobos foram processados para histologia/medição de fibrose. A análise das proteínas do fluido do BAL é inserida neste relatório para permitir que sejam feitas comparações com a análise do fluido do BAL de camundongos normais tratados com mu3G9 no Biogen IDEC.
3. Coleta do Lavagem Broncoalveolar. Os camundongos foram eutanizados com uma overdose de injeção intraperitoneal (IP) de Inactina (Sigma). A traquéia foi exposta usando, na maioria das vezes, dissecação cega. A traquéia foi então aberta com tesouras entre os dois anéis de cartilagem e uma agulha de ponta cega de calibre 23 foi inserida na traquéia. A agulha foi mantida no lugar por grampeamento leve com um grampo temporário Schwarts (Roboz). BAL foi realizado por injeção de 0,8 ml_ de solução salina tamponada com fosfato sem Ca2+ ou Mg2+ (PBS) nos pulmões. O fluido foi então retraído na seringa, sem aplicação de muita pressão, e transferido para um tubo Falcon de polipropileno, 15 ml_, no gelo. O procedimento é então repetido, o fluido do BAL é sugado de volta na seringa sem exercer excessiva pressão negativa. As amostras são armazenadas no gelo e são processadas para contagens de células, diferenciais, e tanto o precipitado de BAL como o fluido são coletados e armazenados a -80°C.
1. O BAL é então girado a 180 g (1.000 rpm) (Beckman GPR), por 10 minutos, em uma centrífuga de mesa, a 4°C. O sobrenadante (fluido do BAL) é então removido e congelado a -80°C. Um mililitro de solução de lise RBC (Sigma) foi adicionado e realizado turbilhonamento por 20 segundos. Foram então efetuadas as contagens de células e de citospinas.
2. As amostras são armazenadas em gelo e contadas usando um hemacitômetro. Foi permitido um minuto depois da aplicação das células ao hemacitômetro e antes da leitura das células para que as células se sedimentassem.
3. 100 ί de suspensões celulares são citogiradas (Thermo-Shandon ) a 500 rpm por 5 minutos, à temperatura ambiente. Preparações de citospina são preparadas colocando-se a solução de células no aparelho de citospina e girando a 500 rpm, por 5 minutos. Deve ser verificado que as concentrações celulares não fiquem muito altas na lâmina; se isso acontecer, gire novamente as amostras. Deixe que as lâminas sequem durante a noite, e efetue a coloração com DiffQuik (Fisher). A coloração é feita de a-cordo com o protocolo do fabricante (DiffQuik ). Uma vez que as lâminas estejam secas e as tampas deslizadas com Permount (Fisher), as células são categorizadas por tipo, contando 100 células aleatoriamente seleciona- das usando um contador de células de laboratório (Fisher).
4. Coleta de pulmão para RNA. Os camundongos foram eutaniza- dos com uma overdose de injeção intraperitoneal (IP) de Inactina (Sigma). O animal é borrifado com EtOH a 70%, e a pele é cortada com um par de tesouras estéreis, a partir do esterno e trabalhando até a cabeça. Uma vez que a pele esteja solta, o esterno e as costelas são cortados para expor o coração e os pulmões. Os pulmões são removidos e colocados em pedaço de gaze estéril para remover quaisquer produtos de sangue e rapidamente colocados, em um tubo de fundo redondo, de polipropileno, 14 mL, de 17 x 100 mm (Fisher). Nitrogénio líquido é adicionado ao tubo de polipropileno contendo os pulmões e colocado sobre gelo. Os pulmões são então armazenados a -80°C.
5. Preparação de RNA. RNA total foi purificado das amostras de tecido de pulmão, congeladas instantaneamente, usando o reagente Qiazol (Qiagen) de acordo com o protocolo do fabricante. A qualidade do RNA foi verificada por eletroforese capilar em Bioanalyzer 2000 (Agilent).
6. Rotular, hibridizar e escanear sondas para caracterização de transcritos. A marcação, hibridização, e coloração das amostras foram efe-tuadas de acordo com o protocolo de Preparação de Alvo Eucariótico do Affymetrix Technical Manual (701021 rev 1) para Análise de Expressão Ge-neChip® (Affymetrix, Santa Clara, CA). Em resumo, 5 μg de RNA total purificado foram usados em um 20 μΙ de reação do Primeiro Filamento com 200 U de SuperScript II (cat N2, 18064-022, Invitrogen) e 0,5 g de iniciador (dT)-T7 {5'-GGCCAGTGAATTGTAATACGACTCACTATAGGGAGGCGG(T)24], a 42°C, por 1 hora. A síntese da segundo filamento foi efetuado pela adição de 40 U de DNA Polimerase de E. coli (cat N2 18010-025, Invitrogen), 2 U de E.coli RNase H (cat N2 18021 -071 , Invitrogen) e 10 U de DNA ligase de £ coli (cat N2 18052-019, Invitrogen) seguido por incubação a 16°C, por 2 horas. A reação de síntese do segundo filamento foi purificado usando o Módulo de Limpeza de Amostra GeneChip®, de acordo com o protocolo do fabricante (cat N2 900371 , Affymetrix, Santa Clara, CA). cDNA purificado foi amplificado usando o kit de rótulo de transcrição de RNA de alto rendimento BioArray (cat Ns 42655-40, Enzo Life Sciences, Inc., Parmingdale, NY) de acordo com o protocolo de fabricante para produzir 70-120 μς de cRNA rotulado com biotina (RNA complementar). Séries de sondas GeneChip® de MgU74Av2, Mg.U 74Bv2, e MgU74Cv2 de camundongo foram pré-hibridiza- das em um Forno de Hibridização 640 GeneChip® (Affymetrix, Santa Clara, CA), de acordo com o protocolo do fabricante. cRNA, marcado, fragmentado, foi ressuspenso em 300 μΙ_ de tampão de hibridização 1X contendo ácido 2- morfolinoetanossulfônico 100 mM, [Na+] 1 M, EDTA 20mM, Tween 20 a 0,01%, 0,5 mg/mL de BSA acetilado, 0,1 mg/mL de DNA de esperma de a- renque, oligo B2 de controle e transcritos de controle bioB 1 ,5pM, bioC 5pM, bioD 25pM, e çre 100pM, e hibridizados para séries de sonda GeneChip®, de acordo com o protocolo do fabricante (Affymetrix, Santa Clara, CA). As séries de sondas GeneChip® hibridizadas foram lavadas e coloridas usando Estreptavidina-Ficoeritrinina (cat N2 S866, Molecular Probes, Eugen, OR) e amplificadas com antiestreptavidina biotinilada (BA-0500, Vector Laboratories, Burlingame, CA) usando Fluidics Station 400 GeneChip® (Affymetrix, Santa Clara, CA). As séries de sondas GeneChip® foram escaneadas usando o Escâner GeneArray (Hewlett Packard, Corvallis, OR).
7. Análises de Dados da Caracterização dos Transcritos. Os es-caneados das séries foram convertidos em arquivos CEL Affymetrix e o conjunto de dados resultantes (grupo de arquivos CEL representando o experimento completo) foram normalizados usando o método Robusto de Média de Microarray (RMA). Análise estatística e clustering usando as Ferramentas de Array BRP v. 3.4.0 - Beta 2 (NCI), ferramentas de exploração GeneS-pring (Agilent) e Spotfire (Spotfire). Análise de Significância de Microarrays (SAM) foi usada para identificar conjuntos de sonda, cujas intensidades de sinal foram alteradas por qualquer dos tratamentos experimentais em comparação com o grupo tratado com PBS com o limite de Taxas de Falsas Descobertas (FDR) ajustado para não exceder 0,01 no limite de confidência (CL). Posterior filtração foi efetuada quando necessária por seleção dos conjuntos de sonda significantemente afetados (FDR<0,01 , CL 0,95) mostrando uma alteração de 2 vezes na intensidade do sinal. Os perfis do grupo resultante de genes e o conjunto de condições experimentais foram analisados e visualizados por clustering hierárquico. Análise de trajeto virtual foi realizado usando a base de dados Ingenuity Pathway Analysis (Ingenuity Systems).
8. Análise Multiplex dos Níveis de Proteína no fluido do BAL. As alíquotas medindo 200 μΙ_ foram tomadas diretamente do fluido do BAL coleta- do cúmo descrito acima. Essas alíquotas foram enviadas para a Rules Based Medicine, Inc. (Austin, TX), onde elas foram analisadas por um painel padrão de proteínas de camundongo usando sua tecnologia com base em Luminex.
9. Análise Estatística. A análise estatística para análise de caracterização de transcritos está descrita acima. As comparações estatísticas na análise dos níveis de proteína no fluido do BAL foram feitas entre o controle de veículo e/ou controle de isótipo, e várias doses do artigo de teste usando análise de variância de uma por meio de (ANOVA). Quando diferenças estatisticamente diferentes foram estabelecidas em uma probabilidade de p<0,5 usando ANOVA, as diferenças significantes foram avaliadas entre os grupos pelo teste de comparação múltiplo de Dunnet.
RESULTADOS
1. Efeitos do tratamento de camundongos com mu3G9: análises de transcritos do pulmão. Os resultados dos estudos de toxicologia em camundongos CD-1 identificados como um órgão alvo para u3G9. Como descrito em detalhes naqueles estudos, inflamação pulmonar consistente com essas constatações nos camundongos nulos de integrina β6 (que são deficientes de integrina β6) é vista em camundongos tratados com mu3G9. Essa inflamação, como avaliada por histopatologia, não é vista frequentemente em doses de 1 mg/kg, mas consistentemente em doses de 10 mg/kg, semanalmente. Para avaliar essa inflamação na linhagem C57B16 (a linhagem usada nos estudos de eficácia descritos acima nos Exemplos 15 e 16), os camundongos foram tratados com mu3G entre 0,3 e 30 mg/kg, semanalmente, e os pulmões^fõTa processados para RNA em análise de microarrays.
2. Análise de Significância de Microarrays (SAM) com o limite FDR de 0,01 e CL 0,95 foi usada para pesquisar genes diferencialmente expressos em uma série de comparações em pares entre o grupo de controle tratado com PBS e cada um dos grupos de tratamentos experimentais, inclu- indo os grupos tratados com 3G9 e o grupo sTGFbRII-lg. Tais análises SAM de pares foram realizadas separadamente para os grupos de tratamento e de recuperação usando seus respectivos controles de PBS. As listas de genes resultantes foram submetidas a uma etapa de filtração adicional para identificar aquelas dos conjuntos de sonda ("probesets") afetados, cujas intensidades de sinal variaram entre os grupos de controle de PBS e quaisquer dos grupos de tratamento mais que 2 vezes. Os resultados estão suma- rizados nas Tabelas 17-1 a 17-6. Alterações significantes na expressão gê- nica satisfazendo os critérios de seleção acima foram observadas nos subgrupos de 10 mg/kg e 30 mg/kg do grupo de tratamento (Tabelas 17-1 e 17- 2). Os perfis da expressão gênica para os conjuntos de sonda selecionados mostram fortes deslocamentos bidirecionais nos níveis de expressão dos genes correspondentes nos grupos de tratamento de 3G9 com 10 mg/kg e 30 mg/kg (figura 66).
Nenhuma alteração estatisticamente significativa de expressão gênica foi detectada em qualquer outro subgrupo de tratamento ou no grupo de recuperação (Tabelas 17-1 e 17-2). Contudo, gene MMP12 e outros 25 genes selecionados para mais que 0,95 correlação de Pearson de seus perfis de expressão com aquele do MMP12, mostraram uma tendência detectável ascendente no grupo de tratamento com 3 mg/kg de 3G9 (figura 67; Tabela 17-7).
Anotação funcional do gene significantemente afetado por 3G9 foi realizada usando a base de dados Ingenuity Pathway Analysis (IPA) e tem mostrado forte associação desses genes com imunorresposta e sinalização de citocinas imunorreguladoras (figura 68). De forma similar, a análise de trajeto regulador virtual sugeriu a associação das alterações induzidas por 3G9 na expressão gênica com alterações na sinalização de quimiocina, TGF-β, e interferon. Essas associações seguem das configurações das duas redes de mais alta classificação (figura 69A, 69B).
2. Análise PCR Quantitativa de Transcritos de MMP-12. MMP-12 mostra o maior número de vezes de supra-regulação de qualquer transcrito nos pulmões de camundongos tratados com mu3G9 (Tabela 17-3). MMP-12 foi previamente reportada como o mais altamente supra-regulado transcrito nos pulmões de camundongos nulos de β6. Para ainda elucidar a relação entre a expressão de MMP-12 e o tratamento com mu3G9, os níveis de transcrito de MMP-12 por PCR quantitativa foram analisados, incluindo RNA preparado dos pulmões de camundongos nulos de β6. O tratamento com mu3G9 produziu um aumento dependente de dose no transcrito de MMP-12 que foi significante em 10 e 30 mg/kg. A alteração de expressão na expressão de MMP-12 foi comparável naquelas doses com aquela vista nos camundongos nulos de β6. Similar aos resultados descritos acima para a análise de microarrays, os níveis de MMP-12 por PCR quantitativa tenderam ascendentemente na dose de 3 mg/kg, mas ficaram inalterados nas doses de 0,3 e 1 mg/kg.
3. Análise de Proteína do BAL dos Pulmões de Camundongos Normais tratados com mu3G9. Para ainda caracterizar as alterações moleculares no pulmão atribuíveis ao tratamento com mu3G9, foram analisados os níveis de 60 proteínas (Tabela 17-8) em fluido do BAL de uma outra coorte de camundongos tratados por 4 semanas com doses de mu3G9 entre 0,1 e 10 mg/kg. A análise das proteínas foi efetuada por ensaio Luminex (análise de proteína Multiplex). Consistentes com essas constatações no nível de transcritos, as proteínas múltiplas com inflamação pulmonar foram elevadas no fluido do BAL de camundongos tratados com 10 mg/kg de dose (Tabela 17-9). Além disso, algumas dessas alterações foram também significantes por ANOVA na dose de 3 mg/kg; contudo, nenhuma proteína no painel foi elevada pela dose de 1 mg/kg.
4. Análise das Proteínas do fluido do BAL do Modelo de Fibrose induzida por Radiação. A eficácia do mu3G9 em atenuar a fibrose pulmonar induzida por radiação está descrita acima no Exemplo 15. Amostras de fluido do BAL (BALF) coletadas naqueles estudos foram analisadas por caracterização das proteínas de multianalisados, usando o mesmo painel de camundongo que foi usado no BALF de camundongos tratados com mu3G9. A análise de BALF dos pontos de tempo da semana 28 (tratamento de 13 semanas) e semana 32 (tratamento de 17 semanas) é efetuada aqui. As proteínas que foram significantemente alteradas conforme determinado por ANO- VA estão resumidas na Tabela 17-11. Como com a caracterização de transcritos e resultados de proteínas nos camundongos normais, a maioria das proteínas que é alterada no modelo de fibrose por radiação atinge significância somente na dose de 10 mg/kg, embora algumas sejam significantes e todas mostrem tendência em 3 mg/kg. A maioria dessas proteínas são cito- cinas ou quimiocinas conhecidas por estarem associadas à fibrose pulmonar. Quatorze das 20 proteínas supra-reguladas por 2 vezes ou mais em camundongos normais tratados com 10 mg/kg de mu3G9 (Tabela 17-10) são também consideradas consistentemente supra-reguladas no modelo de radiação. Apesar das diferenças no período de tratamento de mu3G9 e no estado de lesão/inflamação, a concordância entre as constatações nos camundongos normais e irradiados é marcante. Muitas das proteínas mostram su-pra-regulação muitas vezes mais alta consistente com o período de tratamento mais longo no modelo de radiação (Tabela 17-12), mas no global as constatações são consistentes nessas duas situações bem diferentes. Além disso, apesar dos diferentes níveis de linha de base nos camundongos normais e irradiados (a lesão por radiação supra-regula a maioria dessas proteínas), a faixa de doses que estes rótulos inflamatórios são supra-regulados é a mesma que nos camundongos normais e irradiados. Especificamente, eles são supra-regulados nas doses de 3 e 10 mg/kg, mas não na dose de 1 mg/kg tanto nos camundongos normais como nos doentes (ilustrados com as quatro proteínas mais altamente supra-reguladas na semana 28 na figura 70). Assim, apesar da expressão muito maior do alvo do fármaco na modelo de radiação (vide Exemplo 15 acima), as doses que produzes alterações das proteínas no BAL específicas para o tratamento com mu3G9 são as mesmas em ambas as situações. É importante notar que nem todas as proteínas induzidas por mu3G9 sejam tidas como tendo efeitos pró-inflamatórios e/ou pró-fibróticos. Por exemplo, a quimiocina de CXCL IP-10/CXCK10 demonstrou eficácia anti-fibrótica potente nos modelos de camundongos, e camundongos deficientes de IP-10 ou de seu receptor CXCR3 mostram uma exagerada resposta fibrótica à bleomicina. Contudo, alterações consistentes não são vistas nesta ou em outras citocinas na dose eficaz próxima da máxima de 1 mg/kg de dose, de modo que é improvável que qualquer uma dessas alterações no meio de citocina do pulmão seja requerida para eficácia do tratamento com mu3G9.
Dentre as proteínas que foram supra-reguladas nos camundon- gos normais, mas não no modelo de radiação, foram ApoA1 , Fibrinogênio, e TIMP-1. Os níveis dessas proteínas e uma quarta proteína, haptoglobina, são aumentados no fluido do BAL dos camundongos irradiados em comparação com os camundongos normais, mas são reduzidos pelo tratamento com mu3G9 (figura 71). Assim, a normalização dos níveis para essas proteí- nas em doses eficazes sugere que eles podem estar agindo com rótulos substitutos da eficácia no ponto de tempo de 28 semanas (figura 72). As únicas proteínas no painel que alteraram significantemente nas doses inferiores foram aquelas que foram reduzidas por tratamento: TIMP-1 e haptoglobina. TIMP-1 é um alvo de TGF-β conhecido e é frequentemente elevado na do- ença fibrótica. Sua infra-modulação é consistente com o mecanismo de ação do mu3G9, isto é, inibe a ativação de TGF-β mediada por ανβ.
Tabelas
Tabela 17-1 : Análise das alterações dos transcritos no pulmão para mu3G9, in vivo, em escalação de dose. Número de conjuntos de sonda significante- mente (FDR < 0,01 , CL 0,95) afetados por tratamentos experimentais



Tabela 17-2: Análise dos transcritos no pulmão com alteração de 2 vezes. Número de conjuntos de sonda mostrando alterações significantems maiores que duas vezes na intensidade de sinal em resposta aos tratamentos experimentais.


Tabela 17-3 Lista de Transcritos

Tabela 17-3 -continuação-


Tabela 17-3 -continuação-

Tabela 17-3 -continuação-

Tabela 17-3 -continuação-

Tabela 17-3 -continuação-


Tabela 17-3 -continuação-

Tabela 17-3 -continuação-


Tabela 17-3 -continuação-

Tabela 17-3 -continuação-

Tabela 17-3 -continuação-


Tabela 17-3 -continuação-

Tabela 17-3 -continuação-

Tabela 17-3 -continuação-

Tabela 17-3 -continuação-

Tabela 17-3 -continuação-

Tabela 17-3 -continuação-

Tabela 17-4: Genes significantemente afetados pelas 30 mg/kg de 3G9 no grupo de tratamento.


Tabela 17-4: -continuação-

Tabela 17-4: -continuação-


Tabela 17-4: -continuação-


Tabela 17-4: -continuação-


Tabela 17-4: -continuação-

Tabela 17-4: -continuação-

Tabela 17-5: Genes significantemente afetados pelos 10 mg/kg de 3G9 e mostrando > duas vezes de alteração na intensidade de sinal dos conjuntos de sonda correspondente

Tabela 17-5: -continuação-

Tabela 17-5: -continuação-

Tabela 17-5: -continuação-


Tabela 17-5: -continuação-


Tabela 17-6: Transcritos alterados mais >2 vezes no grupo de 3 mg/kg. Genes especificamente afetados por 30 mg/kg de 3G9 e mostrando alteração >2 vezes na intensidade de sinal do conjunto de sonda correspondente no grupo de tratamento

Tabela 17-6: -continuação-

Tabela 7-6: -continuação-


4

Tabela 17-7: Transcritos mostrando uma tendência ascendente no grupo de 3 mg/kg

Tabela 17-7: -continuação-

Tabela 17-8 Proteínas Totais Analisadas por Formação de Perfil das Proteínas do Multi-Analisados


Tabela 17-8 -continuação


Tabela 17-8 -continuação-

Tabela 17-9: Proteínas alteradas em diferentes doses de tratamento com mu3G9

Tabela 17-10: Proteínas do BALF com alteração maior que 2 vezes nos ca¬


Tabela 17-11 : Proteínas do Fluido do BAL alteradas significantemente no modelo de radiação


Tabela 17-11: -continuação-


Tabela 17-12: Comparação das vezes de alteração nas proteínas do BAL em camundongos normais e irradiados



CONCLUSÕES
Os efeitos do tratamento com mu3G9 têm sido caracterizados em camundongos normais por caracterização dos transcritos e por caracterização das proteínas dos analisados múltiplos:
(A) Análise de caracterização de transcritos dos pulmões de camundongos tratados com altas doses de mu3G9 induz significantes alterações em vários transcritos associados à inflamação pulmonar. Essas altera-ções são consistentes com os resultados da caracterização dos transcritos de camundongos nulos de β6 (deficientes de νβ6). Os alvos específicos que são erroneamente regulados são consistentes com a reduzida sinalização de TGF-ββ no pulmão devido ao mecanismo de ação do mu3G9.
(b) Os resultados da caracterização das proteínas demonstram igualmente aumentos consistentes em algumas citocinas e quimiocinas as- sociadas ao mecanismo de ação do mu3G9.
(c) Alterações nos transcritos alcançam significância somente na dose de 10 mg/kg, embora vários transcritos apresentem uma tendência ascendente na dose de 3 mg/kg. Algumas das alterações de proteínas são sig- nificantes na dose de 3 mg/kg, mas a maioria alcança significância na dose de 10 mg/kg. Nenhuma alteração na proteína ou no transcrito é significante na dose de 1 mg/kg.
Os efeitos do tratamento com mu3G9 têm sido caracterizados no modelo de fibrose por radiação por caracterização das proteínas dos anali-sados múltiplos:
(a) Muitas das mesmas citocinas e quimiocinas induzidas por alta dose de mu3G9 em camundongos normais também aumentaram na dose alta de mu3G9 no modelo de fibrose por radiação.
(b) Apesar a expressão muito mais alta do alvo do mu3G9, inte-grina ( νβ6, as elevações nestes rótulos inflamatórios são vistos nas mesmas doses no modelo de radiação e nos camundongos normais, isto é elevação nas 3 e 10 mg/kg, mas não na 1 mg/kg, que é uma dose eficaz próxima da máxima neste modelo (vide Exemplo 15).
Algumas proteínas associadas à fibrose, especialmente TIMP-1 e haptoglobina, foram normalizadas pelo tratamento com mu3G9 nas doses eficazes no ponto de tempo de 28 semanas.
REFERÊNCIAS
Annes JP, Rifkin DB, Munger JS. The integrin avB6 binds and activa-tes latent TGFB3. FEBS lett 2002; 511 :65-68.
Bonniaud P, Kolb M, Gait T, Robertson J, Robbins C, Stampfii M, La-very C, Margetts PJ, Roberts AB, Gauldie J. Smad3 null mice develop airs-pace enlargement and are resistant to TGF-beta-mediated pulmonary fibro-sis. J Immunol. 2004; 173(3):2099-108.
Bonniaud P, Margetts PJ, Schroeder JA, Kapoun AM, Damm D, Mur-phy A, Chakravarty S, Dugar S, Higgins L, Protter AA and others. Progressive TGF-(beta)l-induced lung fibrosis is blocked by an orally active ALK5 ki-nase inhibitor. Am J Respir Crit Care Med. 2004.

Breuss JM, Gallo J, DeLisser HM, Klimanskaya IV, Folkesson HG, Pittet JF, Nishimura S, Aldape K, Landers DV, Carpenter W et al. Expression of the R6 subunit in development, neoplasia and tissue repair suggests a role in epithelial remodeling. J Celi Sci 1995; 108:2241 -2251.
Chevalier RL, Goyal S, Kim A, Landau D, LeRoith D. Renal tubuloin- terstitial injury from ureteral obstruction in the neonatal rat is attenuated by IGF-I. Kidney Int 2000; 57:882-890.
Collard HR, Ryu JH, Douglas WW, Schwarz Ml, Curran-Everett D, King TE, Brown KK. Combined Corticosteroid and Cyclophosphamide Therapy does not alter survival in Idiopathic Pulmonary Fibrosis. Chest 2004; 125:2169-2174.
Coultas DB, Zumwalt RE, Black WC Sobonya RE. The Epidemiology of Interstitial Lung Disease. Am J Respir Crit Care Med 1994; 150:967-972.
Cosgrove D, Meehan D, Grunkemeyer JA, Kornak JM, Sayers R, Hunter WJ, Samuelson GC. Collagen COL4A3 knockout: a mouse model for au-tosomal Alport syndrome. Genes Dev 1996; 10:2981-2992.
Douglas WW, Ryu JH, Swensen SJ, Offord KP, Schroeder DR, Caron GM, Remee RA. Colchicine versus Prednisone in the Treatment of Idiopathic Pulmonary Fibrosis: a randomized prospective study. Am J Respir Crit Care Med 1998; 158:220-225.
Eickelberg O, Kohler E, Reichenberger F, Bertschin S, Woodtli T, Erne P, Perruchoud AP, Roth M. Extracellular matrix deposition by primary human lung fibroblasts in response to TGF-betal and TGF-beta3. Am J Physiol 1999 276(5):L814-L824.
Flaherty KR, Toesw GB, Lynch JP, Kazerooni EA, Gross BH, Straw-derman RL, Hariharan K, Flint A, Martinez FJ. Steroids in Idiopathic Pulmonary Fibrosis: A prospective assessment of adverse reactions, response to therapy, and survival. Am J Med 2001 ; 110:278-282.
George J, Roulot D, Koteliansky VE, Bissell DM. In vivo inhibition of rat stellate cell activation by soluble transforming growth factor type II receptor: A potential new therapy for hepatic fibrosis. Proc Natl Acad Sci, USA 1999; 96(22): 12719-12724.

Gleizes PE, Munger JS, Nunes I, Harpel JG, Mazzieri R, Noguera I, Rifkin DB. TGF-beta latency: biological significance and mechanisms of acti- vation. Stern Cells 1997; 15:190-197.
Hakkinen L, Hildebrand HC, Berndt A, Kosmehl H, Larjava H. Immu- nolocalization of tenascin-C, alpha9 integrin subunit, and alphavbeta6 integrin during wound healing in human oral mucosa. J Histochem Cytochem. 2000 48(7):985-98.
Hakkinen L, Koivisto L, Gardner H, Saarialho-Kre U, Carroll JM, Lakso M, Rauvala H, Laato , Heino J, Larjava H. Increased expression of beta6-integrin in skin leads to spontaneous development of chronic wounds. Am J Pathol 2004 164(l):229-42.
Huang XZ, Wu JF, Cass D, Erie DJ, Corry D, Young SG, Farese RV Jr, Sheppard D. Inactivation of the integrins in regulating inflammation in the lung and skin. J Celi Biol. 1996 May; 133(4): 921 -8.
Huang X, Wu J, Spong S, Sheppard D. The integrin alphavbeta6 is criticai for keratinocyte migration on both its known ligand, fibronectin, and on vitronectin. J Celi Sei 1998; 111 :2189-95.
Kaminski N, Belperio JA, Bitterman PB, Chen L, Chensue SW, and others. Idiopathic Pulmonary Fibrosis. Proceedings of the 1st Annual Pitts-burgh International Lung Conference. October 2002. Am J Respir Celi Mol Biol. 2003 Sep;29(3 Suppl):SI-105.
Kasuga H, Ito Y, Sakamoto S, Kawachi H, Shimizu F, Yuzawa Y, S. M. Effects of anti-TGF-β type II receptor antibody on experimental glomeru-lonephritis, Kid Lit 2001 ;60: 1745-1755.
Laping NJ. ALK5 Inhibition in renal disease. Curr Opin Pharmacol 2003; 3(2):204-208.
Ma LJ, Yang H, Gaspert A, Carlesso G, Barty MM, Davidson JM, Sheppard D, Fogo AB. Transforming growth factor- -dependent and inde-pendent pathways of induction of tubulointerstitial fibrosis in B6-/- mice. Am J Pathol 2003; 163:1261-1273.
Miner JH, Sanes JR. Molecular and functional defeets in kidneys of mice lacking collagen a3(IV): implications for alport syndrome. J Celi Biol 1996; 135:1403-1413.
Miyajima A, Chen J, Lawrence C, Ledbetter S, Soslow RA, Stern J, Jha S, Pigato J, Lemer ML, Poppas DP, Vaughan ED, Felsen D. Antibody to transforming growth factor-beta ameliorates tubular apoptosis in unilateral ureteral obstruction. Kidney Int 2000; 58(6):2301 -13.
Morris DG, Huang X, Kaminski N, Wang Y, Shapiro SD, Dolganov G, Glick A, Sheppard D. Loss of integrin alpha(v)beta6- médiated TGF -beta activation causes Mmpl2-dependent emphysema. Nature. 2003 Mar 13; 422(6928): 130-1.
Munger JS, Harpel JG, Gleizes PE, Mazzieri R, Nunes l5 Rifkin DB. Latent transforming growth factor-beta: structural features and mechanisms of activation. Kidney Int 1997; 51 :1376-1382.
Munger JS, Huang X, Kawakatsu H, Griffiths MJD, Dalton SL, Wu J, Pittet JF, Kaminski N, Garat C, Matthay MA and others. The integrin ανβ6 binds and activates latent TGF i: a mechanism for regulating pulmonary in-flammation and fibrosis. Celi 1999; 96:319-328.
Pittet J. F., Griffiths M. J., Geiser T., Kaminski N., Dalton S. L, Huang X., Brown L. A., Gotwals P. J., Koteliansky V. E., Matthay M. A. and others. TGF-beta is a criticai mediator of acute lung injury. J Clin Invest 2001 ; 107(12):1537-1544.
Roberts AB, Sporn MB. Regulation of endothelial cell growth, architec-ture, and matrix synthesis by TGF-beta. Am Rev Respir Dis 1989; 140:1126-1128.
Roberts AB, Sporn MB, Assoian RK, Smith JM, Roche NS, Wakefíled LM, Heine Ul, Liotta LA, Falanga V, Kehrl JH and others. Transforming growth factor type B: Rapid induction of fibrosis and angiogenesis in vivo and sti-mulation of collagen formation in vitro. Proc Natl Acad Sei, USA 1986; 83:4167-4171.
Selman M. Idiopathic pulmonary fibrosis challenges for the future. Chest 2001 ; 120(1 ): 8-10.
Sleijfer-S. Bleomycin-induced pneumonitis. Chest 2001 ; 120(2): 617- 24.

Sharma K, Jin Y, Guo J, Ziyadeh FN. Neutralization of TGF-β antibody attenuates kidney hypertrophy and the enhanced extracellular matrix gene expresssion in STZ-induced diabetic mice. Diabetes 1996; 45:522-530.
Sime PJ, Xing Z, Graham FL, Csalcy KG, Gauldie J. Adeno vector- mediated gene transfer of active transforming growth factor-βΙ induces pro- longed severe fibrosis in rat lung. J Clin Invest 1997; 100:768-776.
Turner-Warwick M, Burrows B, Johnson A. Cryptogenic fibrosin alveo-litis: response to corticosteroid treatment and its effect on survival. Thorax 1980; 35:593-599.
Varga J, Rosenbloom J, Jimenez SA. Transforming growth factor beta

(TGF beta) causes a persistent increase in steady-state amounts of type I and type III collagen and fibronectin mRNAs in normal human dermal fibro-blasts. Biochem J 1987; 247(3):597-604.
Wang Q, Hyde DM, Gotwals PJ, Gin SN. Effects of delayed treatment with soluble transforming growth factor-beta receptor in a three-dose ble-omycin model of lung fibrosis in hamsters. Exp Lung Res 2002; 28(6):405-17.

Weinreb PH, Simon KJ, Rayhorn P, Yang WJ, Leone DR, Dolinski BM, Pearse BR, Yokota Y, Kawakatsu H, Atakilit A and others. Function-blocking integrin ανβ6 monoclonal antibodies. J Biol Chem 2004; 279(17):17875-17887.
Zheng H, Wang J, Koteliansky V, J. GP, Hauer- Jensen M. Recombi-nant soluble transforming growth factor β type II receptor ameliorates radiati-on enterophay in mice. Gastroenterology 2000; 119:1286-1296.
Zisman DA, Lynch JP, Toews GB, Kazerooni EA, Flint A, Martinez FJ. Cyclophosphamide in the Treatment of Idiopathic Pulmonary Fibrosis. Chest 2000; 117:1619-1626.
Ziyadeh FN, Hoffman BB, Han DC, lglesias-de la Cruz MC, Hong SW, Isono M, Chen S, McGowan TA, Sharma K. Long-term prevention of renal insuf-ficiency, excess matrix gene expression, and glomerular mesangial matrix ex-pansion by treatment with monoclonal antitransforming growth factor-β antibody in db/db diabetic mice. Proc Natl Acad Sei, USA 2000; 97(14):8015-8020.
Foi agora descrito inteiramente a presente invenção em alguns detalhes a título de ilustração e exemplo para clareza de entendimento, será óbvio para aquele com versado na técnica que a mesma pode ser realizada por modificação ou alteração da invenção dentro de uma ampla e equivalente faixa de condições, formulações e outros parâmetros sem afetar o escopo da invenção ou qualquer modalidade específica desta, e que tais modificações ou alterações são tidas como englobadas pelo escopo das reivindicações apensas.
Todas as publicações, patentes e pedidos de patentes mencionados neste relatório descritivos são indicadores do nível de conhecimento daqueles versados na técnica à qual a invenção pertence, e são aqui incorporados a título de referência na mesma extensão como se cada publicação, patente, ou pedido de patente individual, fosse, específica e individualmente, indicado para ser incorporado a título de referência.

LISTAGEM DE SEQÚÊNCIA
SEQ ID NQ: 1 (Cadeia pesada 3G9 Humanizada: VH3-7FR1 , murino 3G9 CDR , VH-3 FR2, Murino 3G9 CDR2, VH-3 FR3, Murino 3G9 CDR3, FR4 de uma sequência comum presente na grande maioria dos anticorpos)
EVQLVESGGGLVQPGGSLM.SCAASGI FS^^¾5v^QAPGKGLE ^A^^^ ^¾^ fjgj RFTCSRDNA
SEQ ID Ne: 2 (Cadeia leve 3G9 Humanizada: L6 FR1 , murino 3G9 CDR1 , L6 FRi , Murino 3G9 CDR2, L6 FR3, Murino 3G9 CDR3, FR4 de uma Sequência comum presente na grande maioria dos anticorpos)
EIVLTQSPATLSLSPGERATLSCl fQQKPGQAPRLLIY ÍGLPARJFSGSGS GTPFTLTISSLEPEDFAVYYC " ?GGGTKVEIK
SEQ ID Ne: 3 (Cadeia pesada 8G6 Humanizada: VH1-2FR1 , murino 3G9 CDR1 , VH1 -2FR2, Murino 3G9 CDR2, VH1 -2FR3, Murino 3G9 CDR3, FR4 de uma Sequência comum presente na grande maioria dos anticorpos)
>VQLVQSGAEVKJ PGASVKVSCf ASGYTFT VRQAPGQGLEWMGl
IWMTRDTSrSTAYMELSRLRSDDTAVYYCAR IBMHBf |WGQGTLVT

SEQ ID Ne: 4 (Cadeia leve 866 Humanizada: L5FR1 , Murino 3G9 CDR1 , L6FR2, Murino 3G9 CDR2, L6 FR3, Murino 3G9 CDR3, FR4 de uma Sequência consensual presente na grande maioria dos anticorpos)
EIVLTQSPATLSLSPGERATLSCi rQQKPGQAPRLLI HPARF SGSGSGTDFTLTISSLEPEDFAVYYC ?GGGTKVEK
S SEEQQ IIDD NNss:: 5 (Vetor pKJS195-cadeia leve versão 5 3G9)



SEQ ID Ng: 6 (Vetor pKJS189-cadeia pesada versão 3 3G9) es


SEQ ID Ns: 7 (Vetor pKJS 196-cadeia pesada versão 3 aglicosil-3G9)

εΐυ sly vai


SEQ ID Ns: 8 (Iniciador de PCR para domínio variável de cadeia pesada de murino 3G9)
5' AGGTCTAGAAYCTCCACACACAGGRRCCAGTGGATAGAC 3'
SEQ ID N9: 9 (Iniciador de PCR para domínio variável de cadeia pesada de murino 3G9) 5' GGGGATATCCACCATGlL\crrCGGGYTGAGCT GGTTTT 3' (S=C G, M=A C, R-A/G, K=G/T, W=A/T, and Y=C/T)
SEQ ID N2: 10 (Iniciador de PCR para domínio variável de cadeia leve de murino 3G9)
5' aCGTCTAGAACTGGATGGTGGGAGATGGA 3'
SEQ ID N9: 11 (Iniciador de PCR para domínio variável de cadeia leve de murino 3G9)
5' GGGGATATCCACCATGGATTTTCAGGTGCAOATTTTCAG 3'
SEQ ID N9: 12 (Iniciador de PCR para construção de cadeia pesada quimérica 3G9
5' CTGTCTCTGCAGGTAAGCTTACACCCCCATCTG 3V
SEQ ID Ns: 13 (Iniciador de PCR para construção de cadeia longa quimérica 3G9
5' CAGATGGGGGTGTAAGCITACCTGCAGAGACAG 3'
SEQ ID Ns: 14 (Iniciador de PCR para construção de cadeia leve quimérica 3G9
5' GGCACCAAGCTGGAGATCTAACGGGCTGATGCTGC 3'
SEQ ID Ns: 15 (Iniciador de PCR para construção de cadeia leve quimérica 3G9
5' GCAGCATCAGCCCGTTAGATCTCCAGCTTGGTGCC 3 '
SEQ ID N9: 16 (Iniciador de PCR para construção de cadeia leve quimérica 3G9
5' GGAACTTACACTTGAGCTGGCACTGCATGTÇAAGG 3'
SEQ ID Ne: 17 (Iniciador de PCR para construção de cadeia leve quimérica 3G9
5' CCTTGACATGCAGTGCCAGCTCAAGTGTAAGTTCC 3 '
SEQ ID N9: 18 (Iniciador de PCR para construção de cadeia pesada hu3G9 versões 1 e 2)
5* GCTGACAGCGGCCGCGGGATCCAC 3'
SEQ ID Ne: 19 (Iniciador de PCR para construção de cadeia pesada hu3G9 versões 1 e 2)
5 ' GCTCACGGTCACCGGTTCGGGG 3 · SEQ ID NQ: 20 (Iniciador de PCR para construção de cadeia leve hu3G9 versões 1 , 2 e 3)
5' GCTGACAOCOGCCaCOGGATCCAC 3*
SEQ ID NQ: 21 (Iniciador de PCR para construção de cadeia leve hu3G9 ver- sões 1 , 2 e 3)
5: GGAAGATGAACACACTGGGTGCGG 3'
SEQ ID Ne: 22 (Filamento superior de 5' oligonucleotídeos fosforilados para cadeia pesada de 3G9 versão 1 )
S'GCTGACAGCGQCCGCGQ jiATCCACCATGGAClTCGGCCrGÀGCTGQG 'QTTC ÍGGTGCTO GTGCTGAAGGGCGTGCAGTGCGAGGTGATGCTGCTGGAGAGCGGCOGC 3'
SEQ ID Ne: 23 (Filamento superior de 5' oligonucleotídeos fosforilados para cadeia pesada de 3G9 versão 1)
5 'GGCCTGGTG AGCCCGGCGGCAaCCrGAGGCTGAGCTGCGCCGGCAGCGGCTTCACCTTC AGCCGCrACGTGATGAGCTGGGTGCGCCAGGCCCCCGGCAAGGGCCTGGAGTGGGTGGCCA G 3'
SEQ ID N9: 24 (Filamento superior de 5' oligonucleotídeos fosforilados para cadeia pesada de 3G9 versão 1)
5'CATCAGCAGCGGAGGCCGCATGTACTACCCCGACACCGTGAAGGGCCGCTrCACCATCAG CCGCGACAGCOCCAAGAACAGCCTGTACCTGCAGATGAACAGCCTGCGCOCCGAGGAC 3

SEQ ID Ns: 25 (Filamento superior de 5' oligonucleotídeos fosforilados para cadeia pesada de 3G9 versão 1 )
5'ACCGCC GTGTACTACTGCGCCCG CGGCAGCATCTACGACGGCTACTACGTGTTCCCCTACT GGGGCCAGGGCACCCTGGTGACCGTGAGCTCCGCCAGCACC 3 '
SEQ ID NQ: 26 (Filamento superior de 5' oligonucleotídeos fosforilados para cadeia pesada de 3G9 versão 1 )
5'AAGGGCCCCAGCGTGTTCCGCCTGGCCCCCAGCAGCAAGAGCACCAGCGGCGGCACCGCC GCCCTGGGCTGCCTGGTGAAGGACTACTTCCCCGAACCGGTGACCGTGAGC 3'
SEQ ID Ns: 27 (Filamento inferior de oligonucleotídeos para cadeia pesada de 3G9 versão 1 )
5' GCTGCACCAGGCCGCCGCCGCTCTCC 3"
SEQ ID Ns: 28 (Filamento inferior de oligonucleotídeo para cadeia pesada de 3G9 versão 1 )
5' CCGCTGCTGATGCTGGCCACCCAC 3"
SEQ ID Ns: 29 (Filamento inferior de oligonucleotídeo para cadeia pesada de 3G9 versão 1)
5' GCAGTAGTACACGGCGGTGTCCTCGGCGCG 3"
SEQ ID N9: 30 (Filamento inferior de oligonucleotídeos para cadeia pesada de 3G9 versão 1 )
5' GCTGGGGCCCTTGGTGCTGGCGG 3"
SEQ ID N9: 31 (Filamento superior de 5' oligonucleotídeos fosforilados para cadeia pesada de 3G9 versão 2)
5'GCTGACAGCGGCCGCGGGATCCACCATGGACltCGGCCTGAGCrGGGTGTTCCTGGTGCTG GTGCTGAAGGGCGTGCAGTGCGAGGTGCAGCTGGTGGAGAGCGGCGGC 3'
SEQ ID Ne: 32 (Filamento superior de 5' oligonucleotídeos fosforilados para cadeia pesada de 3G9 versão 2)
5'GGCCTGGTGCAGCCCGGCGGCAGCCTGAGGCTGAGCTGCGCCGCCAGCGGCTTCACCTrC AGCCGCTACGTGATGAGCTGGGTGCGCCAGGCCCCCGGCAAGGGCCTGGAGTGGGTGGCCA G 3'
SEQ ID N5: 33 (Filamento superior de 5' oligonucleotídeos fosforilados para cadeia pesada de 3G9 versão 2)
5'CATCAGGAGCGGAGGCCGCATGTACTACCCCGACACCGTGAAGGGCCGCTTCACCATCAG CCGCGACAGCGCCAAGAACAGCCTGTACCTGCAGATGAAC AGCCTGCGCGCCGAGGAC 3 ' SEQ ID Ns: 34 (Filamento superior de 5' oligonucleotídeos fosforilados para cadeia pesada de 3G9 versão 2)
5'ACCGCCGTGTACTACTGCGCCCGCGGCAGCATCTACGACGGCTACTACGTGTTCCCCTACT GGGGCCAGGGCACCCTGGTGAÇCGTGAGCTCCGCCAGCACC 3'
SEQ ID Ns: 35 (Filamento superior de 5' oligonucleotídeos fosforilados para cadeia pesada de 3G9 versão 2)
5,AAGGGCCCCAGCGTGTTCCCCC GGCCCCCAGCAGCAAGAGCACCAGCGGCGGCACCGCC GCCCTGGGCTGCCTGGTGAAGGACTACTTCCCCGAACCGGTGACCGTGAGC 3'
SEQ ID N9: 36 (Filamento inferior de oligonucleotídeos para cadeia pesada de 3G9 versão 2)
5' GCTGCACCAGGCCGCCGCCGCTCTCC 3"

SEQ ID N9: 37 (Filamento inferior de oligonucleotídeos para cadeia pesada de 3G9 versão 2)
5' CCGCTGCTGATGCTGGCCACCCAC 3"

SEQ ID N9: 38 (Filamento inferior de oligonucleotídeos para cadeia pesada de 3G9 versão 2) S^CAGTAGTACACGGCGGTGTCCTCGGCGCG S''
SEQ ID N9: 39 (Filamento inferior de oligonucleotídeos para cadeia pesada de 3G9 versão 2)
5' GCTGGGGCCCTTGGTGCTGGCGG 3"
SEQ ID N9: 40 (Iniciador de PCR para cadeia pesada de 3G9 versão 3)

5 ' CCATCAGCÇGQGACAACGCCAAGAACAGCCTG 3 '
SEQ ID N9: 41 (Iniciador de PCR para cadeia pesada de 3G9 versão 3)
5' CAGGCTGTTCTTGGCGTTGTCGCGGCTGATGG 3'
SEQ ID Ns: 42 (Filamento superior de 5' oligonucleotídeos fosforilados para cadeia leve de 3G9 versão 1)
SOCTGACAOCGQCCGCOGOATCCACCATGGACTTCCAGGTGCAGATCTTCAGCÍTCCTGCTG ATCAGCOTGAOCGTGATC ATGAGCCOCGGCGAGATCGTGCTGACC 3 »
SEQ ID N9: 43 (Filamento superior de 5' oligonucleotídeos fosforilados para cadeia leve de 3G9 versão 1 )
5'CAGAGCCCCGCCACCCTGAGCCTGAGCCCCGGCGAGAGGGCCACCCTGAGCTGCAGCGCC AGCAGC AGCGTGAGCAGCAGCTACCTGTACTGGTACCAGCAGAAGCCCGGCCAGGCC 3 * SEQ ID N9: 44 (Filamento superior de 5' oligonucleotídeos fosforilados para cadeia leve de 3G9 versão 1)
5'CCCAGGCTGTGGATCTACAGCACCAGCAACCTGGCCAGCGGCGTGCCCGTGCGCTTCAGC GGCAGCGGCAGCGGCACCGACTTCACCCrGACCATCAGCAGCCTGGAGCCCGAGGAC 3'

SEQ ID N9: 45 (Filamento superior de 5' oligonucleotídeos fosforilados para cadeia leve de 3G9 versão 1 )
5'TTCGCCGTGTACTTCTGCCACCAGrGGAGCACCTACCCCCCCACCTTCGGCGGCGGCACCA AGGTGGAGATCAAGCGTACGGTGGCCGCACCCAGTGTOTTCATC1TCC 3'
SEQ ID N9: 46 (Filamento inferior de oligonucleotídeos para cadeia leve de 3G9 versão 1 )
5' GCGGGGC CTGGGTÇAGCACGATC 3"

SEQ ID Ns: 47 (Filamento inferior de oligonucleotídeos para cadeia leve de 3G9 versão 1 )
5' CCACAGCCTGGGGGCCTGGCCG 3"
SEQ ID N9: 48 (Filamento inferior de oligonucleotídeos para cadeia leve de

3G9 versão 1)
5'GTACACGGCGAAGTCCTCGGGCTC 3" SEQ ID N9: 49 (Filamento superior de 5' oligonucleotídeos fosforilados para cadeia leve de 3G9 versão 2)
5'GCTGACAGCGGCCGCGGGArcCACCATW^
ATCAGCGTGAGCGTGATCATGAGCCGCGGCGAGATCGTGCTGACC 3'
SEQ ID Ne: 50 (Filamento superior de 5' oligonucleotídeos fosforilados para cadeia leve de 3G9 versão 2)
SOAGAGCCCCGCCACCCIGAGCCTGAGCCCCGGCGAGAGGGCCACCCTGAGCTGCAGCGCC AGCAGCAGCGTGAGCAGCAGCTACCTGTACTGGTACCAGCAGAAGCCCGGCCAGGCC 3 '

SEQ ID Ns: 51 (Filamento superior de 5' oligonucleotídeos fosforilados para cadeia leve de 3G9 versão 2)
5'CCCAGGCTGTGGATCTACAGCACCAOCAACCTGGCCAGCGGCGTGCGCGCCCGCnCAGC GGCAGCGGCAGCGGCACCGACTTCACCCTGACCATCAQCAOCCrQOAaCCCGAGGAC 3' SEQ ID N9: 52 (Filamento superior de 5' oligonucleotídeos fosforilados para cadeia leve de 3G9 versão 2)
S'TTCGC.CGTGTACTACTGCCACCAGTGGAGCACCTACCCCCCCACCTTCGGCGGCGGCACCA AGGTGGAGATCAAGCGTACGGTGGCCGCACCCAGTGTGTTCATCTTCC 3 *
SEQ ID Ns: 53 (Filamento inferior de oligonucleotídeos para cadeia leve de

3G9 versão 2)
5* GCGGGGCTCTGGGTCAGCACGATC 3"
SEQ ID N9: 54 (Filamento inferior de oligonucleotídeos para cadeia leve de 3G9 versão 2)
5' CCACAGCCTGGGGGCCTGGCCG 3"
SEQ ID N9: 55 (Filamento inferior de oligonucleotídeos para cadeia leve de 3G9 versão 2)
5' GTACACGGCGAAGTCCTCGGGCTC 3"
SEQ ID Ne: 56 (Filamento superior de 5' oligonucleotídeos fosforilados para cadeia leve de 3G9 versão 3)
5'GCTGACAGCGGCCGCGGGATCCACCATGGACTTCCAGGTGCAGATCTTCAGCTTCCTGCTG ATCAGCGTGAGCGTGATCATGAGCCGCGGCGAGATCGTGCTGACC 3'
SEQ ID Nõ: 57 (Filamento superior de 5' oligonucleotídeos fosforilados para cadeia leve de 3G9 versão 3)
5'CAGAC CCCGCCACCCTGAGCCTGAGCCCCC 5CGAGAGGGCCACCCTGAGCTGCAGCGCC AGCAGCAGCGTGAGCAGCAGCTACCTGTACTGGTACCAGCAGAAGCCCGGCCAGGCC 3'

SEQ ID Nõ: 58 (Filamento superior de 5' oligonucleotídeos fosforilados para cadeia leve de 3G9 versão 3)
S CCAGGCTGTGGATCTACAGCACCAGCAACCTGGCCAGCGOCATCCCCGCCCOCTICAÍKICT GCAGCGGCAGCGGCACCGACTTCACCCTGACCATCAGCAGCCTGGAGCCCGAGGAC 3'
SEQ ID N-: 59 (Filamento superior de 5' oligonucleotídeos fosforilados para cadeia leve de 3G9 versão 3)
STTCGCCGTGTACTACTGCCACCAGTGGAGCACCTACCCCCCCACCTTCGGCGGCGGCACCA AGGTGGAGATCAAGCGTACGGTGGCCGCACCCAGTGTGTTCATCTTCC 3'
SEQ ID NQ: 60 (Filamento inferior de oligonucleotídeos para cadeia leve de 3G9 versão 3)
5' GCGGGGCTCTGGGTCAGCACGATC 3"
SEQ ID NQ: 61 (Filamento inferior de oligonucleotídeos para cadeia leve de 3G9 versão 3)
5' CCACAGCCTGGGGGCCTGGCCG 3"
SEQ ID N5: 62 (Filamento inferior de oligonucleotídeos para cadeia leve de 3G9 versão 3)
5 ' GTACACG G CG AAGTCCTCGGGCTC 3"
SEQ ID Ne: 63 (Iniciador de PCR para criação de cadeia leve de 369 versão 4)
5 'GTCAGCACGATCTGGCCGCGGCTCATGATC 3'
SEQ ID Ne: 64 (Iniciador de PCR para criação de cadeia leve de 369 versão 4)
5' GATCATGAGÇCGCGGCCAGATCGTGCTGAC 3'
SEQ ID Ne: 65 (Iniciador de PCR para criação de cadeia leve de 369 versão 5)
5 'CCCAGGCTGCTGATCTACAGCACC 3 '
SEQ ID N9: 66 (Iniciador de PCR para criação de cadeia leve de 369 versão 5)
5'GGTGCTGTAGATCAGCAGCCTGGG 3'
SEQ ID NQ: 67 (cadeia leve de hu3G9 versão 1) 1 GAGATCGTGCTGACCCAGAGCCCÇGCCACCCTGAGCCTGAGCCCCGGCGAGAGGGCCACC

E I L T Q S P A T L S L S P G E R A T 61 CTGAGCTGCAGCGCCAGCAGCAGCGTGAGCAGCAGCTACCTGTACTGGTACCAGCAGAAG

L S C S A S S S V S S S Y L Y W Y Q Q K 121 CCCGGCCAGGCCCCCAGGCTGTGGATCTACAGCACCAGCAACCTGGCCAGCGGCGTGCCC

P G Q A P R L W I Y S T S N L A S G V P 181 GTGCGCTTCAGCGGCAGCGGCAGCGGCACCGACTTÇACCCTGACCATCAGCAGCCTGGAG

V R F S G S G S G T D F T L T I S S L E 241 CCCGAGGACTTCGCCGTGTACTTCTGCCACCAGTGGAGCACCTACCCCCCCACCTTCGGC

P E D F A V Y F C H Q W S T P P T F G 301 GGCGGCACCAAGGTGGAGATCAAG
G G T K V E I K

SEQ ID Ne: 68 (cadeia leve de hu3G9 versão 2)
1 GAGATCGTGCTGACCCAGAGCCCCGCCACCCTGAGCCTGAGCCCCGGCGAGAGGGCCACC

E I V L T Q S P A L S L S P G E R A T 61 CTGAGCTGCAGCGCCAGCAGCAGCGTGAGCAGCAGCTACCTGTACTGGTACCAGCAGAAG

L S C S A S S S V S S S Y L Y Y Q Q K 121 CCCGGCCAGGCCCCCAGGCTGTGGATCTACAGCACCAGCAACCTGGCCAGCGGCGTGCCC

P G Q A P R L 1 Y S T S N L A S G V P 181 GCCCGCTTCAGCGGCAGCGGCAGCGGCACCGACTTCACCCTGACCATCAGCAGCCTGGAG

A F S G S G S G T D F T L T I S S L E 241 CCCGAGGACTTCGCCGTGTACTACTGCCACCAGTGGAGCACCTACCCCCCCACCTTCGGC

P E D F A V Y Y C H Q W S T Y P P T F G 301 GGCGGCACCAAGGTGGAGATCAAG
G G T K V E I

SEQ ID N9: 69 (cadeia leve de hu3G9 versão 3)
1 GAGATCGTGCTGACCCAGAGCCCCGCCACCCTGAGCCTGAGCCCCGGCGAGAGGGCCACC E I V L T Q S P A L S L S P G E R A T

61 CTGAGCTGCAGCGCCAGCAGCAGCGTGAGCAGCAGCTACCTGTACTGGTACCAGCAGAAG L S C S A S S S V S S S Y L Y Y Q Q K

121 CCCGGCCAGGCCCCCAGGCTGTGGATCTACAGCACCAGCAACCTGGCCAGCGGCATCCCC P G Q A P R L W I Y S T S N .L A S G I P

181 GCCCGCTTCAGCGGCAGCGGCAGCGGCACCGACTTCACCCTGACCATCAGCAGCCTGGAG A R F S G S G S G T D F T L T I S S L E

241 CCCGAGGACTTCGCCGTGTACTACTGCCACCAGTGGAGCACCTACCCCCCCACCTTCGGC P.E D F A V Y Y C H Q W S T Y P P T F G

301 GGCGGCACCAAGGTGGAGATCAAG
G G T K V E I K

SEQ ID Ne: 70 (cadeia leve de hu3G9 versão 4)
1 CAGATCGTGCTGACCCAGAGCCCCGCCACCCTGAGCCTGAGCCCCGGCGAGAGGGCCACC

Q I V L T Q S P A T L S L S P G E R A T 61 CTGAGCTGCAGCGCCAGCAGCAGCGTGAGCAGCAGCTACCTGTACTGGTACCAGCAGAAG

L S C S A S S S V S S S Y L Y W Y Q Q K 121 CCCGGCCAGGCCCCCAGGCTGTGGATCTACAGCACCAGCAACCTGGCCAGCGGCATCCCC

P G Q A P R L W I Y S T S N L A S G I P 181 GCCCGCTTCAGCGGCAGCGGCAGCGGCACCGACTTCACCCTGACCATCAGCAGCCTGGAG

A R F S G S G S G T D F T L T I S S L E 241 CCCGAGGACTTCGCCGTGTACTACTGCCACCAGTGGAGCACCTACCCCCCCACCTTCGGC

P E D F A V Y Y C H Q W S T Y P P T F G 301 GGCGGCACCAAGGTGGAGATCAAG
G G T K V E I K

SEQ ID Ne: 71 (cadeia leve de hu3G9 versão 5) 1 GAGATCGTGCTGACCCAGAGCCCCGCCACCCTGAGCCTGAGCCCCGGCGAGAGGGCCACC

E I V L T Q S P A T L S L S P G E R A T 61 CTGAGCTGCAGCGCCAGCAGCAGCGTGAGCAGCAGCTACCTGTACTGGTACCAGCAGAAG

L S C S A S S S V S S S Y L Y Y Q Q K 121 CCCGGCCAGGCCCCCAGGCTGCTGATCTACAGCACCAGCAACCTGGCCAGCGGCATCCCC

P G Q A P R L L I Y S T S N L A S G I P 181 GCCCGCTTCAGCGGCAGCGGCAGCGGCACCGACTTCACCCTGACCATCAGCAGCCTGGAG

A R F S G S G S G T D F T L I S S L E 2 1 CCCGAGGACTTCGCCGTGTACTACTGCCACCAGTGGAGCACCTACCCCCCCACCTTCGGC

P B D F A V Y Y C H Q W S T Y P P T F G 301 GGCGGCACCAAGGTGGAGATCAAG
G G T K V E I K

SEQ ID Ne: 72 (cadeia pesada de hu3G9 versão 1 )
1 GAGGTGATGCTGGTGGAGAGCGGCGGCGGCCTGGTGCAGCCCGGCGGCAGCCTGAGGCTG

E V M L V E S G G G L V Q P G G S L R L 61 AGCTGCGCCGCCAGCGGCTTCACCTTCAGCCGCTACGTGATGAGCTGGGTGCGCCAGGCC

S C A A S G F T F S R Y V M S W V R Q A 121 CCCGGCAAGGGCCTGGAGTGGGTGGCCAGCATCAGCAGCGGAGGCCGCATGTACTACCCC

P G K G L E K V A S I S S G G R M Y Y P 181 GACACCGTGAAGGGCCGCTTCACCATCAGCCGCGACAGCGCCAAGAACAGCCTGTACCTG

D T V K G R F T I S R D S A K N S L Y L

241 CAGATGAACAGCCTGCGCGCCGAGGACACCGCCGTGTACTACTGCGCCCGCGGCAGCATC

Q M N S L R A E D T A V Y Y C A R G S I 301 TACGACGGCTACTACGTGTTCCCCTACTGGGGCCAGGGCACCCTGGTGACCGTGAGCTCC

Y D G Y Y V F P Y W G Q G T L V T V S S

SEQ ID N9: 73 (cadeia pesada de hu3G9 versão 2)
1 GAGGTGCAGCTGGTGGAGAGCGGCGGCGGCCTGGTGCAGCCCGGCGGCAGCCTGAGGCTG
E V Q L V E S G G G L V Q P G G S L R L
61 AGCTGCGCCGCCAGCGGCTTCACCTTCAGCCGCTACGTGATGAGCTGGGTGCGCCAGGCC
S C A A S G F T F S R Y V M S W V R Q A
121 CCCGGCAAGGGCCTGGAGTGGGTGGCCAGCATCAGCAGCGGAGGCCGCATGTACTACCCC
F G K G L E W V A S I S S G G R M Y P
181 GACACCGTGAAGGGCCGCTTCACCATCAGCCGCGACAGCGCCAAGAACAGCCTGTACCTG
D T V K G R F T I S R D S A N S L Y I» 241 CAGATGAACAGCCTGCGCGCCGAGGACACCGCCGTGTACTACTGCGCCCGCGGCAGCATC
Q M N S L R A E D T A V Y Y C A R G S I
301 TACGACGGCTACTACGTGTTCCCCTACTGGGGCCAGGGCACCCTGGTGACCGTGAGCTCC
Y D G Y Y V F E Y W G Q G T L V T S S

SEQ ID Ne: 74 (cadeia pesada de hu3G9 versões 3 ou 5)
1 GAGGTGCAGCTGGTGGAGAGCGGCGGCGGCCTGGTGCAGCCCGGCGGCAGCCTGAGGCTG

E V Q L V E S G G G L V Q P G G S L R L 61 AGCTGCGCCGCCAGCGGCTTCACCTTCAGCCGCTACGTGATGAGCTGGGTGCGCCAGGCC

S C A A S G F T F S R Y V M S W V R Q A 121 CCCGGCAAGGGCCTGGAGTGGGTGGCCAGCATCAGCAGCGGAGGCCGCATGTACTACCCC

P G K G L E W V A S I S S G G R M Y Y P 181 GACACCGTGAAGGGCCGCTTCACCATCAGCCGCGACAACGCCAAGAACAGCCTGTACCTG D T V K G R F T 1 S R D N A K N S L Y L

241 CAGATGAACAGCCTGCGCGCCGAGGACACCGCCGTGTACTACTGCGCCCGCGGCAGCATC

Q M N S L R A E D T A V Y Y C A G S I 301 TACGACGGCTACTACGTGTTCCCCTACTGGGGCCAGGGCACCCTGGTGACCGTGAGCTCC

Y D G Y Y V F P Y W G Q G T L V T V S S

SEQ ID N°: 75 (cadeia leve de hu8G6 versão 1) DIVLTQSPATLSLSPGERATLSÍ l QQKPGQAPRFLI }IPARF SGSGSGTDFTLTISSLEPEDFAVYYCE FGGGTKVEIK

SEQ ID Ns: 76 (cadeia leve de hu8G6 versão 2)
EIVLTQSPATLSLSPGERATLSÍ fQQKPGQAPRFLI SGIPARFS GSGSGTDFILTISSLEPEDFAVYYC FGGGTKVEIK

SEQ ID Ne: 77 (cadeia leve de hu8G6 versão 3)
EIVLTQSPATLSLSPGERATLSC¾H PRLLI 8S&3StSB SGSGSGTDFTLTISSLEPEDFAVYy(¾ SFGGGTKVEIK
SEQ ID Ne: 78 (cadeia pesada de hu8G6 versão 1 )
^LVOSGAEVKKPGASVKVSCKGSSYTFT}
T ΓΓVDKSI5TAY IELSRLRSDDTAVYYCAR^ | GQGTLVTV

SEQ ID Ne: 79 (cadeia pesada de hu8G6 versão 2)



SEQ ID - 80 (cadeia pesada de hu8G6 versão 3)
QVQLVQSGAEVIOJGASVKVSCl^SGYTFTBIS^ia APGQGLEWM
^TivlTVDKSISTAYMELSRLRSDDTAVYYCARS /GQGTLVT

VSS

LISTAGEM DE SEQUENCIA
<110> Violette, Shelia M.
Koopman, Louisa A.
Simon, Kenneth J.
Weinreb, Paul H.
van Vlijmen, Herman W.T.
Saldanha, Jose W.
Lugovskoy, Alexey A.
<120> ANTICORPOS ANTI-ALFAVBETA6 E USOS DESTES
<130> 2159.0840002
<140> US 11/483,190
<141> 2006-07-10
<150> US 60/773,310
<151> 2005-07-08
<150> US 60/697,442
<151> 2005-07-08
<160> 152
<170> Patentln versão 3.3
<210> 1
<211> 120
<212> PRT
<213> Sequência Artificial
<220>
<223> Cadeia pesada 3G9 humanizada
<400> 1
Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly

1 5 10 15

Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Arg Tyr

20 25 30
Val Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val

35 40 45
Ala Ser Ile Ser Ser Gly Gly Arg Met Tyr Tyr Pro Asp Thr Val Lys 50 55 60
Gly Arg Phe Thr lie Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr Leu 65 70 75 80

Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala
85 90 95

Arg Gly Ser lie Tyr Asp Gly Tyr Tyr Val Phe Pro Tyr Trp Gly Gln

100 105 110
Gly Thr Leu Val Thr Val Ser Ser
115 120
<210> 2
<211> 108
<212> PRT
<213> Sequência Artificial
<220>
<223> Cadeia leve 3G9 humanizada
<400> 2
Glu lie Val Leu Thr Gln Ser Pro Ala Thr Leu Ser Leu Ser Pro Gly

1 5 10 15

Glu Arg Ala Thr Leu Ser Cys Ser Ala Ser Ser Ser Val Ser Ser Ser

20 25 30
Tyr Leu Tyr Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Arg Leu Leu

35 40 45
lie Tyr Ser Thr Ser Asn Leu Ala Ser Gly lie Pro Ala Arg Phe Ser

50 55 60
Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr lie Ser Ser Leu Glu 65 70 75 80

Pro Glu Asp Phe Ala Val Tyr Tyr Cys His Gln Trp Ser Thr Tyr Pro
85 90 95

Pro Thr Phe Gly Gly Gly Thr Lys Val Glu lie Lys
100 105
<210> 3
<211> 125 <212> PRT
<213> Sequência Artificial
<220>
<223> Cadeia pesada 8G6 humanizada
<400> 3
Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala 1 5 10 15

. Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe Asp Tyr Ala 20 25 30
Met His Trp Val Arg Gln . Ala Pro Gly Gln Gly Leu Glu Trp Met Gly

35 40 45
Val lie Ser Thr Tyr Tyr Gly Asn Thr Asn Tyr Asn Gln Lys Phe Lys

50 55 60
Gly Arg Val Thr Met Thr Arg Asp Thr Ser lie Ser Thr Ala Tyr Met 65 70 75 80

Glu Leu Ser Arg Leu Arg Ser Asp Asp Thr Ala Val Tyr Tyr Cys Ala
85 90 95

Arg Gly Gly Leu Arg Arg Gly Asp Arg Pro Ser Leu Arg Tyr Ala Met

100 . 105 110
Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser
115 120 125
<210> 4
<211> 111
<212> PRT
<213> Seqttência Artificial
<220>
<223> Cadeia leve 8G6 humanizada
<400> 4
Glu lie Val Leu Thr Gln Ser Pro Ala Thr Leu Ser Leu Ser Pro Gly 1 5 10 15

Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gln Ser Val Ser Thr Ser 20 25 30 Ser Tyr Ser Tyr Met Tyr Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro

35 40 45
Arg Leu Leu Ile Tyr Tyr Ala Ser Asn Leu Glu Ser Gly Ile Pro Ala

50 55 60
Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser 65 70 75 80

Ser Leu Glu Pro Glu Asp Phe Ala Val Tyr Tyr Cys Gln His Asn Trp
85 90 95

Glu Ile Pro Phe Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys
100 105 110
<210> 5
<211> 711
<212> DNA
<213> Sequência Artificial
<220>
<223> vetor pKJS195 - versão 3G9 de cadeia leve 5
<220>
<221> CDS
<222> (1) .. (711)
<400> 5
atg gac ttc cag gtg cag ate ttc age ttc ctg ctg ate age gtg age Met Asp Phe Gln Val Gln Ile Phe Ser Phe Leu Leu Ile Ser Val Ser 1 5 10 15 gtg ate atg age ege ggc gag ate gtg ctg acc cag age cec gec acc Val Ile Met Ser Arg Gly Glu Ile Val Leu Thr Gln Ser Pro Ala Thr

. 20 25 30 ctg age ctg age cec ggc gag agg gec acc ctg age tgc age gec age Leu Ser Leu Ser Pro Gly Glu Arg Ala Thr Leu Ser Cys Ser Ala Ser

35 40 45
age age gtg age age age tac ctg tac tgg tac cag cag aag cec ggc Ser Ser Val Ser Ser Ser Tyr Leu Tyr Trp Tyr Gln Gln Lys Pro Gly 50 55 60 cag gcc ccc agg ctg ctg ate tac age acc age aac ctg gcc age ggc 240 Gln Ala Pro Arg Leu Leu lie Tyr Ser Thr Ser Asn Leu Ala Ser Gly
65 70 75 80 ate ccc gcc ege ttc age ggc age ggc age ggc acc gac ttc acc ctg 288 lie Pro Ala Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu
85 90 95
acc ate age age ctg gag ccc gag gac ttc gcc gtg tac tac tgc cac 336 Thr lie Ser Ser Leu Glu Pro Glu Asp Phe Ala Val Tyr Tyr Cys His
100 105 110
cag tgg age acc tac ccc ccc acc ttc ggc ggc ggc acc aag gtg gag 384 . Gln Trp Ser Thr Tyr Pro Pro Thr Phe Gly Gly Gly Thr Lys Val Glu
115 120 125
ate aag cgt aeg gtg get gea cca tet gtc ttc ate ttc ceg cca tet 432 lie Lys Arg Thr Val Ala Ala Pro Ser Val Phe lie Phe Pro Pro Ser
130 135 140
gat gag cag ttg aaa tet gga act gcc tet gtt gtg tgc ctg ctg aat 480 Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn
145 150 155 160 aac ttc tat ccc aga gag gcc aaa gta cag tgg aag gtg gat aac gcc 528 Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala
165 170 175
etc caa teg ggt aac tec cag gag agt gtc aca gag cag gac age aag 576 Leu Gln Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln Asp Ser Lys
180 185 190
gac age acc tac age etc age age acc ctg aeg ctg age aaa gea gac 624 Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp
195 200 205
tac gag aaa cac aaa gtc tac gcc tgc gaa gtc acc cat cag ggc ctg 672 Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu
210 215 220
age teg ccc gtc aca aag age ttc aac agg gga gag tgt 711 Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys 225 230 235
<210> 6
<211> 1404
<212> DNA
<213> Sequência Artificial
<220>
<223> vetor pKJS189 - vetor 3G9 3 de cadeia pesada
<220>
<221> CDS
<222> (1) .. (1404)
<400> 6
atg gac ttc ggc ctg age tgg gtg ttc ctg gtg ctg gtg ctg aag ggc 48 Met Asp Phe Gly Leu Ser Trp Val Phe Leu Val Leu Val Leu Lys Gly
1 5 10 15
gtg cag tgc gag gtg cag ctg gtg gag age ggc ggc ggc ctg gtg cag 96 Val Gln Cys Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln
20 25 30
cec ggc ggc age ctg agg ctg age tgc gcc gcc age ggc ttc acc ttc 144 Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe
35 40 45
age cgc tac gtg atg age tgg gtg cgc cag gcc cec ggc aag ggc ctg 192 Ser Arg Tyr Val Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu .
50 55 60
gag tgg gtg gcc age ate age age gga ggc cgc atg tac tac cec gac 240 Glu Trp Val Ala Ser Ile Ser Ser Gly Gly Arg Met Tyr Tyr Pro Asp
65 70 75 80
acc gtg aag ggc cgc ttc acc ate age cgc gac aac gcc aag aac age 288 Thr Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser
85 90. 95
ctg tac ctg cag atg aac age ctg cgc gcc gag gac acc gcc gtg tac 336 Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr
100 105 110 tac tgc gcc ege ggc age ate tac gac . ggc tac tac gtg ttc ccc tac 384 Tyr Cys Ala Arg Gly Ser lie Tyr Asp Gly Tyr Tyr Val Phe Pro Tyr
115 120 125
tgg ggc cag ggc acc ctg gtg acc gtg age tec gcc age acc aag ggc 432 Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly
130 135 140
ccc agc gtg ttc ccc ctg gcc ccc age age aag age acc age ggc ggc 480 Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly
145 150 155 160 acc gcc gcc ctg ggc tgc ctg gtg aag gac tac ttc ccc gaa ccg gtg 528 Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val
165 170 175
acg gtg tcg tgg aac tca ggc gcc ctg acc age ggc gtg cac acc ttc 576 Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe
180 185 190
ccg gct gtc cta cag tec tca gga ctc tac tec ctc age age gtg gtg 624 Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val
195 200 205
acc gtg ccc tec age age ttg ggc acc cag acc tac ate tgc aac gtg 672 Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr lie Cys Asn Val
210 215 220
aat cac aag ccc age aac acc aag gtg gac aag aaa gtt gag ccc aaa 720 Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys
225 230 235 240 tct tgt gac aag act cac aca tgc cca ccg tgc cca gea ect gaa ctc 768 Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu
245 250 255
ctg ggg gga ccg tca gtc ttc ctc ttc ccc cca aaa ccc aag gac acc 816 Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr
260 265 270
ctc atg ate tec cgg acc ect gag gtc aca tgc gtg gtg gtg gac gtg 864 Leu Met lie Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val 275 280 285
age cac gaa gac ect gag gtc aag ttc aac tgg tac gtg gac ggc gtg 912 Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val
290 295 300
gag gtg cat aat gec aag aca aag ceg cgg gag gag cag tac aac age 960 Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser
305 310 315 320 acg tac cgt gtg gtc age gtc ctc acc gtc ctg cac cag gac tgg ctg 1008 Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu
325 330 335
aat ggc aag gag tac aag tgc aag gtc tcc aac aaa gec ctc cca gec 1056 Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala
340 345 350
cec ate gag aaa acc ate tcc aaa gec aaa ggg cag cec ega gaa cca 1104 Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro
355 360 365 '
cag gtg tac acc ctg cec cca tcc cgg gat gag ctg acc aag aac cag 1152 Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln
370 375 380
gtc age ctg acc tgc ctg gtc aaa ggc ttc tat cec age gac ate gec 1200 Val Ser Leu Thr Cys . Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala
385 390 395 400 gtg gag tgg gag age aat ggg cag ceg gag aac aac tac aag acc acg 1248 Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr
405 410 415
ect cec gtg ttg gac tcc gac ggc tcc ttc ttc ctc tac age aag ctc 1296 Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu
420 425 430
acc gtg gac aag age agg tgg cag cag ggg aac gtc ttc tca tgc tcc 1344 Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser
435 440 445
gtg atg cat gag gct ctg cac aac cac tac acg cag aag age ctc tcc 1392 Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser
450 455 460
ctg tct ccc ggt 1404 Leu Ser Pro Gly
465
<210>. 7
<211> 1404
. <212> DNA
<213> Sequência Artificial
<220>
<223> vetor pKJS 196 - cadeia pesada de aglicosil 369 versão 3
<220>
<221> CDS
<222> (1)..(1404)
<400> 7
atg gac ttc ggc ctg age tgg gtg ttc ctg gtg ctg gtg ctg aag ggc 48 Met Asp Phe Gly Leu Ser Trp Val Phe Leu Val Leu Val Leu Lys Gly
1 5 10 15
gtg cag tgc gag gtg cag ctg gtg gag age ggc ggc ggc ctg gtg cag 96 Val Gln Cys Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln
20 25 30
ccc ggc ggc age ctg agg ctg age tgc gcc gcc age ggc ttc acc ttc 144 Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe
35 40 45
age cgc tac gtg atg age tgg gtg cgc cag gcc ccc ggc aag ggc ctg 192 Ser Arg Tyr Val Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu
50 55 60
gag tgg gtg gcc age ate age age gga ggc cgc atg tac tac ccc gac 240 Glu Trp Val Ala Ser lie Ser Ser Gly Gly Arg Met Tyr Tyr Pro Asp
65 70 75 80
acc gtg aag ggc cgc ttc acc ate age cgc gac aac gcc aag aac age 288 Thr Val Lys Gly Arg Phe Thr lie Ser Arg Asp Asn Ala Lys Asn Ser 85 90 95 ctg tac ctg cag atg aac age ctg cgc gcc gag gac acc gcc gtg tac Leu Tyr Leu Gln Met Asn. Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr 100 105 110 tac tgc gcc cgc ggc age ate tac gac ggc tac tac gtg ttc ccc tac Tyr Cys Ala Arg Gly Ser Ile Tyr Asp Gly Tyr Tyr Val Phe Pro Tyr 115 120 125
tgg ggc cag ggc acc ctg gtg acc gtg age tec gcc age acc aag ggc Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly 130 135 140
ccc age gtg ttc ccc ctg gcc ccc age age aag age acc age ggc ggc Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly 145 150 155 160 acc gcc gcc ctg ggc tgc ctg gtg aag gac tac ttc ccc gaa ceg gtg Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val
165 170 175 aeg gtg teg tgg aac tca ggc gcc ctg acc age ggc gtg cac acc ttc Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe 180 185 190 ceg get gtc cta cag tec tca gga etc tac tec etc age age gtg gtg Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val 195 200 205
acc gtg ccc tec age age ttg ggc acc cag acc tac ate tgc aac gtg Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val 210 215 220
aat cac aag ccc age aac acc aag gtg gac aag aaa gtt gag ccc aaa Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys 225 230 235 240 tet tgt gac aag act cac aca tgc cca ceg tgc cca gea ect gaa etc Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu
245 250. 255 ctg ggg gga ceg tca gtc ttc etc ttc ccc cca aaa ccc aag gac acc Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr
260 265 270
ctc atg ate tec cgg acc ect gag gtc aca tgc gtg gtg gtg gac gtg 864 Leu et Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val
275 280 285
age cac gaa gac ect gag gtc aag ttc aac tgg tac gtg gac ggc gtg 912 Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val
290 295 300
gag gtg cat aat gec aag aca aag ceg cgg gag gag cag tac cag age 960 Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Gln Ser
305 310 315 320 açg tac cgt gtg gtc age gtc ctc acc gtc ctg cac cag gac tgg ctg 1008 Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu
325 330 335
aat ggc aag gag tac aag tgc aag gtc tec aac aaa gec ctc cca gec 1056 Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala
340 345 350
cec ate gag aaã acc ate tec aaa gec aaa ggg cag cec ega gaa cca 1104 Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro
355 360 365
cag gtg tac acc ctg cec cca tec cgg gat gag ctg acc aag aac cag 1152 Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln
370 375 380
gtc age ctg acc tgc ctg gtc aaa ggc ttc tat cec age gac ate gec 1200 Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala
385 390 395 400 gtg gag tgg gag age aat ggg cag ceg gag aac aac tac aag acc aeg 1248 Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr
405 410 415
ect cec gtg ttg gac tec gac ggc tec ttc ttc ctc tac age aag ctc 1296 Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu
420 425 430 acc gtg gac aag agc agg tgg cag cag ggg aac gtc ttc tca tgc tcc 1344

Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser
435 440 445
gtg atg cat gag gct ctg cac aac cac tac acg cag aag agc ctc tcc 1392

Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser
450 455 460
ctg tct ccc ggt 1404

Leu Ser Pro Gly
465
<210> 8
<211> 39
<212> DNA
<213> Sequência Artificial
<220>
<223> Iniciador de PCR para domínio variável de cadeia pesada de murino 3G9 <400> 8
aggtctagaa yctccacaca caggrrccag tggatagac 39 <210> 9
<211> 39
<212> DNA
<213> Sequência Artificial
<220>
<223> Iniciador de PCR para domínio variável de cadeia pesada de murino 3G9 <400> 9
ggggatatcc accatgract tcgggytgag ctkggtttt 39 <210> 10 ,
<211> 29
<212> DNA
<213> Sequência Artificial
<220>
<223> Iniciador de PCR para domínio variável de cadeia leve de muriho 3G9 <400> 10 gcgtctagaa ctggatggtg ggagatgga 29 <210> 11
<211> 39
<212> DNA
<213> Seqtiência Artificial
<220>
<223> Iniciador de PCR para domínio variável de cadeia leve de murino 3G9 <400> 11
ggggatatcc accatggatt ttcaggtgca gattttcag 39 <210> 12
<211> 33
<212> DNA
<213> Sequência Artificial
<220>
<223> Iniciador de PCR para construção de cadeia leve quimérica 3G9 <400> 12
ctgtctctgc aggtaagctt acacccccat ctg 33 <210> 13
<211> 33
<212> DNÀ
<213> Sequência Artificial
<220>
<223> Iniciador de PCR para construção de cadeia leve quimérica 3G9 <400> 13
cagatggggg tgtaagctta cctgcagaga cag 33 <210> 14
<211> 35
<212> DNA
<213> Sequência Artificial
<220>
<223> Iniciador de PCR para construção de cadeia leve quimérica 3G9 <400> 14 ggcaccaagc tggagatcta acgggctgat gctgc 35 <210> 15
<211> 35
<212> DNA
<213> Sequência Artificial
<220>
<223> Iniciador de PCR para construção de cadeia leve quimérica 3G9 <400> 15
gcagcatcag cccgttagat ctccagcttg gtgcc 35 <210> 16
<211> 35
<212> DNA
<213> Sequência Artificial
<220>
<223> Iniciador de PCR para construção de cadeia leve quimérica 3G9 <400> 16
ggaacttaca cttgagctgg cactgcatgt caagg 35 <210> 17 .
<211> 35
<212> DNA
<213> Sequência Artificial
<220>
<223> Iniciador de PCR para construção de cadeia leve quimérica 3G9 <400> 17
ccttgacatg cagtgccagc tcaagtgtaa gttcc 35 <210> 18
<211> 24
<212> DNA
<213> Sequência Artificial
<220>
<223> Iniciador de PCR para construção de cadeia pesada hu3G9 versões 1 e 2 <400> 18 gctgacagcg gccgcgggat ccac 24 <210> 19
<211> 22
<212> DNA
<213> Sequência Artificial
<220>
<223> Iniciador de PCR para construção de cadeia pesada hu3G9 versões 1 e <400> 19
gctcacggtc accggttcgg gg 22 <210> 20
<211> 24
<212> DNA
<213> Sequência Artificial
<220>
<223> Iniciador de PCR para construção de cadeia leve hu3G9 versões 1, 2 e <400> 20
gctgacagcg gccgcgggat ccac 24 <210> 21
<211> 24
<212> DNA
<213> Sequência Artificial
<220>
<223> Iniciador de PCR para construção de cadeia leve hu3G9 versões 1, 2 e <400> 21
ggaagatgaa cacactgggt gcgg 24 <210> 22
<211> 109
<212> DNA
<213> Seqtiência Artificial
<220>
<223> Filamento superior de 5 ' oligonucleotídeos fosforilados para cadeia pesada 3G9 <400> 22 gctgacagcg gccgcgggat ccaccatgga cttcggcctg agctgggtgt tcctggtgct 60 ggtgctgaag ggcgtgcagt gcgaggtgat gctggtggag agcggcggc 109

<210> 23
<211> 122
<212> DNA
<213> Sequência Artificial
<220>
<223> Filamento superior de 5 Oligonucleotídeos fosforilados para cadeia pesada 3G9 <400> 23
ggcctggtgc agcccggcgg cagcctgagg ctgagctgcg ccgccagcgg cttcaccttc 60 agccgctacg tgatgagctg ggtgcgccag gcccccggca agggcctgga gtgggtggcc 120 ag 122

<210> 24
<211> 118
<212> DNA
<213> Sequência Artificial
<220>
<223> Filamento superior de 5 Oligonucleotídeos fosforilados para cadeia pesada 3G9
<400> 24
catcagcagc ggaggccgça tgtactaccc cgacaccgtg aagggccgct tcaccatcag 60 ccgcgacagc gccaagaaca gcctgtacct gcagatgaac agcctgcgcg ccgaggac 118 <210> 25
<211> 102
<212> DNA
<213> Sequência Artificial
<220>
<223> Filamento superior de 51 oligonucleotídeos fosforilados para cadeia pesada 3G9

<400> 25
accgccgtgt actactgcgc ccgcggcagc atctacgacg gctactacgt gttcccctac 60 tggggccagg gcaccctggt gaccgtgagc tccgccagca cc 102 <210> 26
<211> 111
<212> DNA
<213> Seqíiência Artificial
<220>
<223> Filamento superior de 5 ' oligonucleotídeos fosforilados para cadeia pesada 3G9 <400> 26
aagggcccca gcgtgttccc cctggccccc agcagcaaga gcaccagcgg cggcaccgcc 60 gccctgggct gcctggtgaa ggactacttc cccgaaccgg tgaccgtgag c 111 <210> 27
<211> 26
<212> DNA
<213> Sequência Artificial
<220>
<223> Filamento inferior de oligonucleotídeos para cadeia pesada 3G9 <400> 27
gctgcaccag gccgccgccg ctctcc 26 <210> 28
<211> 24
<212> DNA
<213> Sequência Artificial
<220>
<223> Filamento inferior de oligonucleotídeos para cadeia pesada 3G9 <400> 28
:cgctgctga tgctggccac ccac 24 ;210> 29
;211> 30
212> DNA
213> Sequência Artificial
220>
223> Filamento inferior de oligonucleotídeos para cadeia pesada 3G9 <400> 29
gcagtagtac acggcggtgt cctcggcgcg 30 <210> 30
<211> 23
<212> DNA
<213> Sequência Artificial
<220>
<223> Filamento inferior de oligonucleotídeos para cadeia pesada 3G9 <400> 30
gctggggccc ttggtgctgg cgg 23 <210> 31
<211>. 109
<212> DNA
<213> Sequência Artificial
<220>
<223> Filamento superior de 5 ' oligonucleotídeos fosforilados para cadeia pesada 3G9 <400> 31
gctgacagcg gccgcgggat ccaccatgga cttcggcctg agctgggtgt tcctggtgct 60 ggtgctgaag ggcgtgcagt gcgaggtgca gctggtggag agcggcggc 109 <210> 32
<211> 122
<212> DNA
<213> Sequência Artificial
<220>
<223> Filamento superior de 5 Oligonucleotídeos fosforilados para cadeia pesada 3G9 <400> 32
ggcctggtgc agcccggcgg cagcctgagg ctgagctgcg ccgccagcgg cttcaccttc 60 agccgctacg tgatgagctg ggtgcgccag gcccccggca agggcctgga gtgggtggcc 120 ag 122 <210> 33
<211> 118
<212> DNA <213> Sequência Artificial
<220>
<223> Filamento superior de 5 ' oligonucleotídeos fosforilados para cadeia pesada 3G9 <400> 33
catcagcagc ggaggccgca tgtactaccc cgacaccgtg aagggccgct tcaccatcag 60 ccgcgacagc gccaagaaca gcctgtacct gcagatgaac agcctgcgcg ccgaggac 118 <210> 34
<211> 102
<212> DNA
<213> Sequência Artificial
<220>
<223> Filamento superior de 5 Oligonucleotídeos fosforilados para cadeia pesada 3G9 <400> 34
accgccgtgt actactgcgc ccgcggcagc atctacgacg gctactacgt gttcccctac 60 tggggccagg gcaccctggt gaccgtgagc tccgccagca cc 102 <210> 35
<211> 111
<212> DNA
<213> Seqiiência Artificial
<220>
<223> Filamento superior de 5 Oligonucleotídeos fosforilados para cadeia pesada 3G9 <400> 35
aagggcccca gcgtgttccc cctggccccc agcagcaaga gcaccagcgg cggcaccgcc 60 gccctgggct gcctggtgaa ggactacttc cccgaaccgg tgaccgtgag c 111 <210> 36
<211> 26
<212> DNA
<213> Sequência Artificial
<220>
<223> Filamento inferior de oligonucleotídeos para cadeia pesada 3G9 <400> 36
gctgcaccag gccgccgccg ctctcc 26 14

<210> 37
<211> 2
<212> DNA
<213> Sequência Artificial
<220>
<223> Filamento inferior de oligonucleotídeos para cadeia pesada 3G9 <400> 37
ccgctgctga tgctggccac ccac 24 <210> 38
<211> 30
<212> DNA
<213> Sequência Artificial
<220>
<223> Filamento inferior de oligonucleotídeos para cadeia pesada 3G9 <400> 38
gcagtagtac acggcggtgt cctcggcgcg 30 <210> 39
<211> 23
<212> DNA
<213> Sequência Artificial
<220>
<223> Filamento inferior de oligonucleotídeos para cadeia pesada 3G9 <400> 39
gctggggccc ttggtgctgg cgg 23 <210> 40
<211> 32
<212> DNA
<213> Sequência Artificial
<220>
<223> Iniciador de PCR para cadeia pesada de 3G9
<400> 40
ccatcagccg cgacaacgcc aagaacagcc tg 32 <210> 41
<211> 32
<212> DNA
<213> Sequência Artificial
<220>
<223 Iniciador de PGR para cadeia pesada de 3G9
<400> 41
caggctgttc ttggcgttgt cgcggctgat gg 32 <210> 42
<211> 106
<212> DNA
<213> Sequência Artificial
<220>
<223> Filamento superior de oligonucleotídeos fosforilados para cadeia leve 3G9 <400> 42
gctgacagcg gccgcgggat ccaccatgga cttccaggtg cagatcttca gcttcctgct 60 gatcagcgtg agcgtgatca tgagccgcgg cgagatcgtg ctgacc 106 <210> 43
<211> 117
<212> DNA
<213> Sequência Artificial
<220>
<223> Filamento superior de oligonucleotídeos fosforilados para cadeia leve 3G9 <400> 43
cagagccccg ccaccctgag cctgagcccc ggcgagaggg ccaccctgag ctgcagcgcc 60 agcagcagcg tgagcagcag ctacctgtac tggtaccagc agaagcccgg ccaggcc 117 <210> 44
<211> 117
<212> DNA
<213> Sequência Artificial
<220>
<223> Filamento superior de oligonucleotídeos fosforilados para cadeia leve 3G9 <400> 44
cccaggctgt ggatctacag caccagcaac ctggccagcg gcgtgcccgt gcgcttcagc 60 ggcagcggca gcggcaccga cttcaccctg accatcagca gcctggagcc cgaggac 117 <210> 45
<211> 109
<212> DNA
<213> Sequência Artificial
<220>
<223> Filamento superior de oligonucleotídeos fosforilados para. cadeia leve 3G9 <400> 45
ttcgccgtgt acttctgcca ccagtggagc acctaccccc ccaccttcgg cggcggcacc 60 aaggtggaga tcaagcgtac ggtggccgca cccagtgtgt tcatcttcc 109 <210> 46
<211> 24
<212> DNA
<213> Sequência Artificial
<220>
<223> Filamento superior de oligonucleotídeos fosforilados para cadeia leve 3G9 <400> 46
gcggggctct gggtcagcac gate 24 <210> 47
<211> 22
<212> DNA
<213> Sequência Artificial
<220>
<223> Filamento superior de oligonucleotídeos fosforilados para cadeia leve 3G9 <400> 47
ccacagcctg ggggcctggc cg 22 <210> 48
<211> 24
<212> DNA
<213> Sequência Artificial <220>
<223> Filamento superior de pligonucleotídeos fosforilados para cadeia leve 3G9 <400> 48
gtacacggcg aagtcctcgg gctc 24

<210> 49
<211> 106
<212> DNA
<213> Sequência Artificial
<220>
<223> Filamento superior de oligonucleotídeos fosforilados para cadeia leve 3G9 <400> 49
gctgacagcg gccgcgggat ccaccatgga cttccaggtg cagatettca gcttcctgct 60 gatcagcgtg agcgtgatca tgagccgcgg cgagatcgtg ctgacc 106 <210> 50
<211> 117
<212> DNA
<213> Sequência Artificial
<220>
<223> Filamento superior de oligonucleotídeos fosforilados para cadeia leve 3G9 <400> 50
cagagccccg ccaccctgag cctgagcccc ggcgagaggg ccaccctgag ctgcagcgcc 60 agcagcagcg tgagcagcag ctacctgtac tggtaccagc agaagcccgg ccaggcc 117 <210> 51
<211> 117
<212> DNA
<213> Sequência Artificial
<220>
<223> Filamento superior de oligonucleotídeos fosforilados para cadeia leve 3G9

<400> 51
cccaggctgt ggatctacag caccagcaac ctggccagcg gcgtgcccgc ccgcttcagc 60 ggcagcggca gcggcaccga cttcaccctg accatcagca gcctggagcc cgaggac 117

<210> 52 <211> 109
<212> DNA
<213> Sequência Artificial
<220>
<223> Filamento superior de oligonucleotídeos fosforilados para cadeia leve 3G9 <400> 52
ttcgccgtgt actactgcca ccagtggagc acctaccccc ccaccttcgg cggcggcacc 60 aaggtggaga tcaagcgtac ggtggccgca cccagtgtgt tcatcttcc 109 <210> 53
<211> 2
<212> DNA
<213> Sequência Artificial
<220>
<223> Filamento superior de oligonucleotídeos fosforilados para cadeia leve 3G9 <400> 53
gcggggctct gggtcagcac gate 24 <210> 54
<211> 22
<212> DNA
<213> Sequência Artificial
<220>
<223> Filamento superior de oligonucleotídeos fosforilados para cadeia leve 3G9 <400> 54
ccacagcctg ggggcctggc cg 22 <210> 55
<211> 24
<212> DNA
<213> Sequência Artificial
<220>
<223> Filamento superior de oligonucleotídeos fosforilados para cadeia leve 3G9 <400> 55
gtacacggcg aagtcctcgg gete 24 <210> 56
<211> 106
<212> DNA
<213> Sequência Artificial
<220>
<223> Filamento superior de oligonucleotídeos fosforilados para cadeia leve 3G9 <400> 56
gctgacagcg gccgcgggat ccaccatgga cttccaggtg cagatcttca gcttcctgct 60 gatcagcgtg agcgtgatca tgagccgcgg cgagatcgtg ctgacc 106 <210> 57
<211> 117
<212> DNA
<213> Sequência Artificial
<220>
<223> Filamento superior de oligonucleotídeos fosforilados para cadeia leve 3G9 <400> 57
cagagccccg ccaccctgag cctgagcccc ggcgagaggg ccaccctgag ctgcagcgcc 60 agcagcagcg tgagcagcag ctacctgtac tggtaccagc agaagcccgg ccaggcc 117 <210> 58
<211> 117
<212> DNA
<213> Sequência Artificial
<220>
<223> Filamento superior de oligonucleotídeos fosforilados para cadeia leve 3G9 <400> 58
cccaggctgt ggatctacag caccagcaac ctggccagcg gcatccccgc ccgcttcagc 60 ggcagcggca gcggcaccga cttcaccctg accatcagca gcctggagcc cgaggac 117 <210> 59
<211> 109
<212> DNA
<213> Sequência Artificial
<220> <223> Filamento superior de oligonucleotídeos fosforilados para cadeia leve 3G9 <400> 59
ttcgccgtgt actactgcca ccagtggagc acctaccccc ccaccttcgg cggcggcacc 60 aaggtggaga tcaagcgtac ggtggccgca cccagtgtgt tcatcttcc 109 <210> 60
<211> 24
<212> DNA
<213> Sequência Artificial
<220>
<223> Filamento superior de oligonucleotídeos fosforilados para cadeia leve 3G9 <400> 60
gcggggctct gggtcagcac gate 24 <210> 61
<211> 22
<212> DNA
<213> Sequência Artificial
. <220>
<223> Filamento superior de oligonucleotídeos fosforilados para cadeia leve 3G9 <400> 61
ccacagcctg ggggcctggc cg 22 <210> 62
<211> 24
<212> DNA
<213> Sequência Artificial
<220>
<223> Filamento superior de oligonucleotídeos fosforilados para cadeia leve 3G9 <400> 62
gtacacggcg aagtcctcgg gete 24 <210> 63
<211> 30
<212> DNA
<213> Sequência Artificial <220>
<223> Iniciador de PCR para criação de cadeia leve 3G9 <400> 63
gtcagcacga tctggccgcg gctcatgatc
<210> 64
<211> 30
<212> DNA
<213> Sequência Artificial
<220>
<223> Iniciador de PCR para criação de cadeia leve 3G9 <400> 64
gatcatgagc cgcggccaga tcgtgctgac
<210> 65
<211> 24
<212> DNA
<213> Seqíiência Artificial
<220>
<223> Iniciador de PCR para criação de cadeia leve 3G9 <400> 65
cccaggctgc tgatctacag cace
<210> 66
<211> 24
<212> DNA
<213> Sequência Artificial
<220>
<223> Iniciador de PCR para criação de cadeia leve 3G9 <400> 66
ggtgctgtag atcagcagcc tggg
<210> 67
<211> 324
<212> DNA
<213> Sequência Artificial <220>
<223> cadeia leve de hu3G9 versão 1
<220>
<221> CDS
<222> (1) .. (324)
<400> 67
gag ate gtg ctg acc cag age cec gec acc ctg age ctg age cec ggc Glu Ile Val Leu Thr Gln Ser Pro Ala Thr Leu Ser Leu Ser Pro Gly 1 5 10 15 gag agg gec acc ctg age tgc age gec age age age gtg age age age Glu Arg Ala Thr Leu Ser Çys Ser Ala Ser Ser Ser Val Ser Ser Ser

20 25 30 tac ctg tac tgg tac cag cag aag cec ggc cag gec cec agg ctg tgg Tyr Leu Tyr Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Arg Leu Trp

35 40 45
ate tac age acc age aac ctg gec age ggc gtg cec gtg ege ttc age Ile Tyr Ser Thr Ser Asn Leu Ala Ser Gly Val Pro Val Arg Phe Ser

50 55 60
ggc age ggc age ggc acc gac ttc acc ctg acc ate age age ctg gag Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Glu 65 70 75 80 cec gag gac ttc gec gtg tac ttc tgc cac cag tgg age acc tac cec Pro Glu Asp Phe Ala Val Tyr Phe Cys His Gln Trp Ser Thr Tyr Pro
85 90 95 cec acc ttc ggc ggc ggc acc aag gtg gag ate aag
Pro Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys
100 105
<210> 68.
<211> 324
<212> DNA
<213> Sequência Artificial
<220> <223> cadeia leve de hu3G9 versão 2
<220>
<221> CDS
<222> (1) .. (324)
<400> 68
gag ate gtg ctg acc cag age ccc gec acc ctg age ctg age ccc ggc Glu lie Val Leu Thr Gln Ser Pro Ala Thr Leu Ser Leu Ser Pro Gly 1 5 10 15 gag agg gec acc ctg age tgc age gec age age age gtg age age age Glu Arg Ala Thr Leu Ser Cys Ser Ala Ser Ser Ser Val Ser Ser Ser

20 25 30 tac ctg tac tgg tac cag cag aag ccc ggc cag gec ccc agg ctg tgg Tyr Leu Tyr Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Arg Leu Trp

35 40 45
ate tac age acc age aac ctg gec age ggc gtg ccc gec cge ttc age lie Tyr Ser Thr Ser Asn Leu Ala Ser Gly Val Pro Ala Arg Phe Ser

50 55 60
ggc age ggc age ggc acc gac ttc acc ctg acc ate age age ctg gag Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr lie Ser Ser Leu Glu 65 70 75 80 ccc gag gac ttc gec gtg tac tac tgc cac cag tgg age acc tac ccc Pro Glu Asp Phe Ala Val Tyr Tyr Cys His Gln Trp Ser Thr Tyr Pro
85 90 95 ccc acc ttc ggc ggc ggc acc aag gtg gag ate aag
Pro Thr Phe Gly Gly Gly Thr Lys Val Glu lie Lys
100 105
<210> 69
<211> 324
<212> DNA
<213> Sequência Artificial
<220>
<223> cadeia leve de hu3G9 versão 3 <220>
<221> CDS
<222> (1)..(324)
<400> 69
gag atc gtg ctg acc cag agc ccc gcc acc ctg agc ctg agc ccc ggc Glu lie Val Leu Thr Gln Ser Pro Ala Thr Leu Ser Leu Ser Pro Gly 1 5 10 15 gag agg gcc acc ctg agc tgc agc gcc agc agc agc gtg agc agc agc Glu Arg Ala Thr Leu Ser Cys Ser Ala Ser Ser Ser Val Ser Ser Ser

20 25 30 tac ctg tac tgg tac cag çag aag ccc ggc cag gcc ccc agg ctg tgg Tyr Leu Tyr Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Arg Leu Trp

35 40 45
atc tac agc acc agc aac ctg gcc agc ggc atc ccc gcc cgc ttc agc lie Tyr Ser Thr Ser Asn Leu Ala Ser Gly lie Pro Ala Arg Phe Ser

50 55 60
ggc agc ggc agc ggc acc gac ttc acc ctg acc atc agc agc ctg gag Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr lie Ser Ser Leu Glu 65 70 75 80 ccc gag gac ttc gcc gtg tac tac tgc cac cag tgg agc acc tac ccc Pro Glu Asp Phe Ala. Val Tyr Tyr Cys His Gln Trp Ser Thr Tyr Pro
85 90 95 ccc acc ttc ggc ggc ggc acc aag gtg gag atc aag
Pro Thr Phe Gly Gly Gly Thr Lys Val Glu lie Lys
100 105
<210> 70
<211> 324
<212> DNA
<213> Sequência Artificial
<220>
<223> cadeia leve de hu3G9 versão 4
<220> <221> CDS
<222> (1)..(324)
<400> 70
cag atc gtg ctg acc cag agc ccc gcc acc ctg agc ctg agc ccc ggc 48

Gln lie Val Leu Thr Gln Ser Pro Ala Thr Leu Ser Leu Ser Pro Gly
1 . 5 10 15
gag agg gcc acc ctg agc tgc agc gcc agc agc agc gtg agc agc agc 96

Glu Arg Ala Thr Leu Ser Cys Ser Ala Ser Ser Ser Val Ser Ser Ser
20 25 30
tac ctg tac tgg tac cag cag aag ccc ggc cag gcc ccc agg ctg tgg 144 Tyr Leu Tyr Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Arg Leu Trp
35 40 45
atc tac agc acc agc aac ctg gcc agc ggc atc ccc gcc cgc ttc agc 192 lie Tyr Ser Thr Ser Asn Leu Ala Ser Gly lie Pro Ala Arg Phe Ser
50 55 60
ggc agc ggc agc ggc acc gac ttc acc ctg acc atc agc agc ctg gag 240 Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr lie Ser Ser Leu Glu
65 70 75 80
ccc gag gac ttc gcc gtg tac tac tgc cac cag tgg agc acc tac ccc 288 Pro Glu Asp Phe Ala Val Tyr Tyr Cys His Gln Trp Ser Thr Tyr Pro
85 90 95
ccc acc ttc ggc ggc ggc acc aag gtg gag atc aag 324 Pro Thr Phe Gly Gly Gly Thr Lys Val Glu lie Lys
100 105
<210> 71
<211> 324
<212> DNA
<213> Sequência Artificial
<220>
<223> hu versão 3G9 de cadeia leve 5
<220>
<221> CDS <222> (1) .. (324)
<400> 71
gag ate gtg ctg acc cag age cec gec acc ctg age ctg age cec ggc Glu Ile Val Leu Thr Gln Ser Pro Ala Thr Leu Ser Leu Ser Pro Gly . 1 5 10 15 gag agg gec acc ctg age tgc age gec age age age gtg age age age Glu Arg Ala Thr Leu Ser Cys Ser Ala Ser Ser Ser Val Ser Ser Ser

20 25 30
tac ctg tac tgg tac cag cag aag cec ggc cag gec cec agg ctg ctg Tyr Leu Tyr Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Arg Leu Leu

35 40 45
ate tac age acc age aac ctg gec age ggc ate cec gec ege ttc age Ile Tyr Ser Thr Ser Asn Leu Ala Ser Gly Ile Pro Ala Arg Phe Ser

50 55 60
ggc age ggc age ggc acc gac ttc acc ctg acc ate age age ctg gag Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Glu 65 70 75 80 cec gag gac ttc gec gtg tac tac tgc cac cag tgg age acc tac cec Pro Glu Asp Phe Ala Val Tyr Tyr Cys His Gln Trp Ser Thr Tyr Pro
85 90 95 cec acc ttc ggc ggc ggc acc aag gtg gag ate aag
Pro Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys
100 105
<210> 72
<211> 360
<212> DNA ,
<213> Sequência Artificial
<220>
<223> cadeia pesada de hu3G9 versão 1
<220>
<221> CDS
<222> (1) .. (360) <400> 72
gag gtg atg ctg gtg gag age ggc ggc ggc ctg gtg cag cec ggc ggc 48

Glu Val Met Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly
1 5 10 15
age ctg agg ctg age tgc gcc gcc age ggc ttc acc ttc age cgc tac 96

Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Arg Tyr
20 25 30
gtg atg age tgg gtg cgc cag gcc cec ggc aag ggc ctg gag tgg gtg 144 Val Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val
35 . · 40. 45
gcc age ate age age gga ggc cgc atg tac tac cec gac acc gtg aag 192 Ala Ser Ile Ser Ser Gly Gly Arg Met Tyr Tyr Pro Asp Thr Val Lys
50 55 60
ggc cgc ttc acc ate age cgc gac age gcc aag aac age ctg tac ctg 240 Gly Arg Phe Thr Ile Ser Arg Asp Ser Ala Lys Asn Ser Leu Tyr Leu
65 70 75 80
cag atg aac age ctg cgc gcc gag gac acc gcc gtg tac tac tgc gcc 288 Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala
85 90 95
cgc ggc age ate tac gac ggc tac tac gtg ttc cec tac tgg ggc cag 336

Arg Gly Ser Ile Tyr Asp Gly Tyr Tyr Val Phe Pro Tyr Trp Gly Gln
100 105 110
ggc acc ctg gtg acc gtg age tec 360 Gly Thr Leu Val Thr Val Ser Ser
115 120
<210> 73
<211> 360
<212> DNA
<213> Sequência Artificial
<220>
<223> cadeia pesada de hu3G9 versão 2
<220> <221> CDS
<222> (1)..(360)
<400> 73
gag gtg cag ctg gtg gag agc ggc ggc ggc ctg gtg cag ccc ggc ggc Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly 1 5 10 15 age ctg agg ctg age tgc gec gec age ggc ttc acc ttc age ege tac Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Arg Tyr

20 25 30 gtg atg age tgg gtg ege cag gec ccc ggc aag ggc ctg gag tgg gtg Val Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val

35 40 45
gec age ate age age gga ggc ege atg tac tac ccc gac acc gtg aag Ala Ser Ile Ser Ser Gly Gly Arg Met Tyr Tyr Pro Asp Thr Val Lys

50 55 60
ggc ege ttc acc ate age ege gac age gec aag aac age ctg tac ctg Gly Arg Phe Thr Ile Ser Arg Asp Ser Ala Lys Asn Ser Leu Tyr Leu 65 70 75 80 cag atg aac age ctg ege gec gag gac acc gec gtg tac tac tgc gec Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala
85 90 95 ege ggc age ate tac gac ggc tac tac gtg ttc ccc tac tgg ggc cag Arg Gly Ser Ile Tyr Asp Gly Tyr Tyr Val Phe Pro Tyr Trp Gly Gln

100 105 110 ggc acc ctg gtg acc gtg age tec
Gly Thr Leu Val Thr Val Ser Ser
115 120
<210> 74
<211> 360
<212> DNA
<213> Sequência Artificial
<220> <223> cadeia pesada de hu3G9 versões 3 e 5
<220>
<221> CDS
<222> (1) .. (360)
<400> 74
gag gtg cag ctg gtg gag agc ggc ggc ggc ctg gtg cag ccc ggc ggc 48 Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly
1 5 10 15
agc ctg agg ctg agc tgc gcc gcc agc ggc ttc acc ttc agc cgc tac 96 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Arg Tyr
20 25 30
gtg atg agc tgg gtg cgc cag gcc ccc ggc aag ggc ctg gag tgg gtg 144 Val Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val
35 40 45
gcc agc atc agc agc gga ggc cgc atg tac tac ccc gac acc gtg aag 192 Ala Ser Ile Ser Ser Gly Gly Arg Met Tyr Tyr Pro Asp Thr Val Lys
50 55 60
ggc cgc ttc acc atc agc cgc gac aac gcc aag aac agc ctg tac ctg 240 Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr Leu
65 70 75 80
cag atg aac agc ctg cgc gcc gag gac acc gcc gtg tac tac tgc gcc 288 Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala
85 90 95
cgc ggc agc atc tac gac ggc tac tac gtg ttc ccc tac tgg ggc cag 336 Arg Gly Ser Ile Tyr Asp Gly Tyr Tyr Val Phe Pro Tyr Trp Gly Gln
100 105 110
ggc acc ctg gtg acc gtg agc tcc 360

Gly Thr Leu Val Thr Val Ser Ser
115 120
<210> 75
<211> 111
<212> PRT <213> Sequência Artificial
<220>
<223> cadeia leve de hu8G6 versão 1
<400> 75
Asp lie Val Leu Thr Gln Ser Pro Ala Thr Leu Ser Leu Ser Pro Gly

1 5 10 15

Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gln Ser Val Ser Thr Ser

20 25 30
Ser Tyr Ser Tyr Met Tyr Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro

35 40 45
Arg Phe Leu lie Lys Tyr Ala Ser Asn Leu Glu Ser Gly lie Pro Ala

50 55 60
Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr lie Ser 65 70 75 80

Ser Leu Glu Pro Glu Asp Phe Ala Val Tyr Tyr Cys Gln His Asn Trp
85 90 95

Glu lie Pro Phe Thr Phe Gly Gly Gly Thr Lys Val Glu lie Lys
100 105 110
<210> 76
<211> 111
<212> PRT
<213> Sequência Artificial
<220>
<223> cadeia leve de hu8G6 versão 2
<400> 76
Glu lie Val Leu Thr Gln Ser Pro Ala Thr Leu Ser Leu Ser Pro Gly

1 5 10 15

Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gln Ser Val Ser Thr Ser

20 25 30
Ser Tyr Ser Tyr Met Tyr Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro

35 40 45
Arg Phe Leu lie Lys Tyr Ala Ser Asn Leu Glu Ser Gly lie Pro Ala 50 55 60
Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser 65 70 75 80

Ser Leu Glu Pro Glu Asp Phe Ala Val Tyr Tyr Cys Gln His Asn Trp
85 90 95

Glu Ile Pro Phe Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys
100 105 110
<210> 77
<211> 111
<212> PRT
<213> Sequência Artificial
<220>
<223> cadeia leve de hu8G6 versão 3
<400> 77
Glu Ile Val Leu Thr Gln Ser Pro Ala Thr Leu Ser Leu Ser Pro Gly

1 5 10 15

Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gln Ser Val Ser Thr Ser

20 25 30
Ser Tyr Ser Tyr Met Tyr Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro

35 40 45
Arg Leu Leu Ile Lys Tyr Ala Ser Asn Leu Glu Ser Gly Ile Pro Ala

50 55 60
Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser 65 70 75 . 80

Ser Leu Glu Pro Glu Asp Phe Ala Val Tyr Tyr Cys Gln His Asn Trp
85 90 95

Glu Ile Pro Phe Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys
100 105 110
<210> 78
<211> 126
<212> PRT
<213> Sequência Artificial <223> cadeia pesada de hu8G6 versão 1
<400> 78
Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala

1 5 10 15

Ser Val Lys Val Ser Cys Lys Gly Ser Ser Tyr Thr Phe Thr Asp Tyr

20 25 30
Ala Met His Trp Val Arg Leu Ala Pro Gly Gln Gly Leu Glu Trp Ile

35 40 45
Gly Val Ile Ser Thr Tyr Tyr Gly Asn Thr Asn Tyr Asn Gln Lys Phe

50 55 60
Lys Gly Arg Ala Thr Met Thr Val Asp Lys Ser Ile Ser Thr Ala Tyr 65 70 75 80

Met Glu Leu Ser Arg Leu Arg Ser Asp Asp Thr Ala Val Tyr Tyr Cys
85 90 95

Ala Arg Gly Gly Leu Arg Arg Gly Asp Arg Pro Ser Leu Arg Tyr Ala

100 105 110
Met Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser
115 120 125
<210> 79
<211> 126
<212> PRT
<213> Sequência Artificial
<220>
<223> cadeia pesada de hu8G6 versão 2
<400> 79
Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala

1 5 10 15

Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Asp Tyr

20 25 30
Ala Met His Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Ile 35 40 45 Gly Val Ile Ser Thr Tyr Tyr Gly Asn Thr Asn Tyr Asn Gln Lys Phe

50 55 60
Lys Gly Arg Ala Thr Met Thr Val Asp Lys Ser Ile Ser Thr Ala Tyr 65 70 75 80

Met Glu Leu Ser Arg Leu Arg Ser Asp Asp Thr Ala Val Tyr Tyr Cys
85 90 95

Ala Arg Gly Gly Leu Arg Arg Gly Asp Arg Pro Ser Leu Arg Tyr Ala

100 105 110
Met Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser
115 120 125
<210> 80
<211> 126
<212> PRT
<213> Sequência Artificial
<220>
<223> cadeia pesada de hu8G6 versão 3
<400> 80
Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala

1 5 10 15

Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Asp Tyr

20 25 30
Ala Met His Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Met

35 40 45
Gly Val Ile Ser Thr Tyr Tyr Gly Asn Thr Asn Tyr Asn Gln Lys Phe

50 55 60
Lys Gly Arg Ala Thr Met Thr Val Asp Lys Ser Ile Ser Thr Ala Tyr 65 70 75 80

Met Glu Leu Ser Arg Leu Arg Ser Asp Asp Thr Ala Val Tyr Tyr Cys
85 90 95

Ala Arg Gly Gly Leu Arg Arg Gly Asp Arg Pro Ser Leu Arg Tyr Ala

100 105 110
Met Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120 125
<210> 81
<211> 97
<212> PRT
<213> Sequência Artificial
<220>
<223> cadeia pesada de hu3G9 para sequência de murino
<400> 81
Glu Val Met Leu Val Glu Ser Gly Gly Gly Leu Val Lys Pro Gly Gly

1 5 10 15

Ser Leu Lys Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Arg Tyr

20 25 30
Val Met Ser Trp Val Arg Gln Thr Pro Glu Lys Arg Leu Glu Trp Val

35 40 45
Ala Ser Ile Ser Ser Gly Gly Arg Met Tyr Tyr Pro Asp Thr Val Lys

50 55 60
Gly Arg Phe Thr Ile Ser Arg Asp Ser Ala Arg Asn Ile Leu Tyr Leu 65 70 75 80

Gln Met Ser Ser Leu Arg Ser Glu Asp Thr Ala Met Tyr Tyr Cys Ala
85 90 95

Arg

<210> 82
<211> 97
<212> PRT
<213> Sequência Artificial
<220>
<223> cadeia pesada de hu3G9 sequência para 3G9HV1
<400> 82
Glu Val Met Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly

1 5 10 15

Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Arg Tyr 20 25 30
Val Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val

35 40 45
Ala Ser Ile Ser Ser Gly Gly Arg Met Tyr Tyr Pro Asp Thr Val Lys

50 55 60
Gly Arg Phe Thr Ile Ser Arg Asp Ser Ala Lys Asn Ser Leu Tyr Leu 65 70 . 75 80

Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala
85 90 95

Arg

<210> 83
<211> 97
<212> PRT
<213> Sequência Artificial
<220>
<223> cadeia pesada de hu3G9 sequência de 3G9HV2
<400> 83
Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly

1 5 10 15

Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Arg Tyr

20 25 30
Val Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val

35 40 45
Ala Ser Ile Ser Ser Gly Gly Arg Met Tyr Tyr Pro Asp Thr Val Lys

50 55 60
Gly Arg Phe Thr Ile Ser Arg Asp Ser Ala Lys Asn Ser Leu Tyr Leu 65 70 75 80

Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala
85 90 95

Arg
<210> 84 <211> 97
<212> PRT
<213> Seqiiência Artificial
<220>
<223> cadeia pesada de hu3G9 sequência 3G9HV3
<400> 84
Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly

1 5 10 15

Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Arg Tyr

20 25 30
Val Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val

35 40 45
Ala Ser Ile Ser Ser Gly Gly Arg Met Tyr Tyr Pro Asp Thr Val Lys

50 55 60
Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr Leu 65 70 75 80

Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala
85 90 95

Arg

<210> 85
<211> 76 .
<212> PRT
<213> Sequência Artificial
<220>
<223> cadeia pesada de hu3G9 sequência para VH3-7
<400> 85
Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly

1 5 10 15

Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Trp Val

20 25 30
Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val Ala Arg Phe Thr Ile 35 40 45
Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr Leu Gln Met Asn Ser Leu

50 55 60
Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg
65 70 75
<210> 86
<211> 98
<212> PRT
<213> Sequência Artificial
<220>
<223> cadeia leve de hu3H9 para sequência de murino
<400> 86
Gln Ile Val Leu Thr Gln Ser Pro Ala Ile Met Ser Ala Ser Pro Gly

1 5 10 15

Glu Lys Val Thr Leu Thr Cys Ser Ala Asn Ser Ser Val Ser Ser Ser

20 25 30
Tyr Leu Tyr Trp Tyr Gln Gln Lys Ser Gly Ser Ser Pro Lys Leu Trp

35 40 45
Ile Tyr Ser Thr Ser Asn Leu Ala Ser Gly Val Pro Val Arg Phe Ser

50 55 60
Gly Ser Gly Ser Gly Thr Ser Phe Ser Leu Thr Ile Ser Ser Met Glu 65 70 75 80

Ala Glu Asp Ala Ala Ser Tyr Phe Cys His Gln Trp Ser Thr Tyr Pro
85 90 95

Pro Thr

<210> 87
<211> 98
<212> PRT
<213> Sequência Artificial
<220>
<223> cadeia leve hu3G9 de sequência 3G9LV1 <400> 87
Glu lie Val Leu Thr Gln Ser Pro Ala Thr Leu Ser Leu Ser Pro Gly

1 5 10 15

Glu Arg Ala Thr Leu Ser Cys Ser Ala Ser Ser Ser Val Ser Ser Ser

20 25 30
Tyr Leu Tyr Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Arg Leu Trp

35 40 45
lie Tyr Ser Thr Ser Asn Leu Ala Ser Gly Val Pro Val Arg Phe Ser

50 55 60
Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr lie Ser Ser Leu Glu 65 70 75 80

Pro Glu Asp Phe Ala Val Tyr Phe Cys His Gln Trp Ser Thr Tyr Pro
85 90 95

Pro Thr
<210> 88
<211> 98
<212> PRT
<213> Sequência Artificial
<220>
<223> cadeia leve de hu3G9 para sequência de 3G9LV2
<400> 88
Glu lie Val Leu Thr Gln Ser Pro Ala Thr Leu Ser Leu Ser Pro Gly

1 5 10 15·

Glu Arg Ala Thr Leu Ser Cys Ser Ala Ser Ser Ser Val Ser Ser Ser

20 25 30
Tyr Leu Tyr Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Arg Leu Trp

35 40 45
lie Tyr Ser Thr Ser Asn Leu Ala Ser Gly Val Pro Ala Arg Phe Ser

50 55 60
Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr lie Ser Ser Leu Glu 65 70 75 80

Pro Glu Asp Phe Ala Val Tyr Tyr Cys His Gln Trp Ser Thr Tyr Pro 85 90 95

Pro Thr
<210> 89
<211> 98
<212> PRT
<213> Sequência Artificial
<220>
<223> cadeia leve de hu3H9 para sequência de 3G9LV3
<400> 89
Glu Ile Val Leu Thr Gln Ser Pro Ala Thr Leu Ser Leu Ser Pro Gly

1 5 10 15

Glu Arg Ala Thr Leu Ser Cys Ser Ala Ser Ser Ser Val Ser Ser Ser

20 25 30
Tyr Leu Tyr Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Arg Leu Trp

35 40 45
Ile Tyr Ser Thr Ser Asn Leu Ala Ser Gly Ile Pro Ala Arg Phe Ser

50 55 60
Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Glu 65 70 75 80

Pro Glu Asp Phe Ala Val Tyr Tyr Cys His Gln Trp Ser Thr Tyr Pro
85 90 95

Pro Thr
<210> 90
<211> 98
<212> PRT
<213> Sequência Artificial
<220>
<223> cadeia leve de hu3H9 para sequência de 3G9LV4
<400> 90
Gln Ile Val Leu Thr Gln Ser Pro Ala Thr Leu Ser Leu Ser Pro Gly

1 5 10 15

Glu Arg Ala Thr Leu Ser Cys Ser Ala Ser Ser Ser Val Ser Ser Ser 20 25 30
Tyr Leu Tyr Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Arg Leu Trp

35 40 45
lie Tyr Ser Thr Ser Asn Leu Ala Ser Gly lie Pro Ala Arg Phe Ser

50 55 60
Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr lie Ser Ser Leu Glu 65 70 75 80

Pro Glu Asp Phe Ala Val Tyr Tyr Cys His Gln Trp Ser Thr Tyr Pro
85 90 95

Pro Thr
<210> 91
<211> 98
<212> PRT
<213> Sequência Artificial
<220>
<223> cadeia leve de hu3H9 para sequência de 3G9LV5
<400> 91
Glu lie Val Leu Thr Gln Ser Pro Ala Thr Leu Ser Leu Ser Pro Gly

1 5 10 15

Glu Arg Ala Thr Leu Ser Cys Ser Ala Ser Ser Ser Val Ser Ser Ser

20 25 30
Tyr Leu Tyr Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Arg Leu Leu

35 40 45
lie Tyr Ser Thr Ser Asn Leu Ala Ser Gly lie Pro Ala Arg Phe Ser

50 55 60
Gly Ser Gly, Ser Gly Thr Asp Phe Thr Leu Thr lie Ser Ser Leu Glu 65 70 75 80

Pro Glu Asp Phe Ala Val Tyr Tyr Cys His Gln Trp Ser Thr Tyr Pro
85 90 95

Pro Thr
<210> 92
<211> 71 <212> PRT
<213> Sequência Artificial
<220>
<223> cadeia leve de hu3H9 para sequência de L6
<400> 92
Glu Ile Val Leu Thr Gln Ser Pro Ala Thr Leu Ser Leu Ser Pro Gly

1 5 10 15

Glu Arg Ala Thr Leu Ser Cys Ser Trp Tyr Gln Gln Lys Pro Gly Gln

20 25 30
Ala Pro Arg Leu Leu Ile Tyr Gly Ile Pro Ala Arg Phe Ser Gly Ser

35 40 45
Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Glu Pro Glu

50 55 60
Asp Phe Ala Val Tyr Tyr Cys
65 70
<210> 93
<211> 98
<212> PRT
<213> Seqtiência Artificial
<220>
<223> cadeia leve de hu3H9 para sequência de murino
<400> 93
Gln Val Gln Leu Gln Gln Ser Gly Pro Glu Leu Val Arg Pro Gly Val

1 5 10 15

Ser Val Lys Ile Ser Cys Lys Gly Ser Ser Tyr Thr Phe Thr Asp Tyr

20 25 30
Ala Met His Trp Val Lys Leu Ser His Ala Lys Ser Leu Glu Trp Ile

35 40 45
Gly Val Ile Ser Thr Tyr Tyr Gly Asn Thr Asn Tyr Asn Gln Lys Phe

50 55 60
Lys Gly Lys Ala Thr Met Thr Val Asp Lys Ser Ser Ser Thr Ala Tyr 65 70 75 80 Met Glu Leu Ala Arg Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr Cys
85 90 95

Ala Arg
<210> 94
<211> 98
<212> PRT
<213> Sequência Artificial
<220>
<223> cadeia pesada de hu3H9 para sequência de 8G6HV1
<400> 94
Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala

1 5 10 15

Ser Val Lys Val Ser Cys Lys Gly Ser Ser Tyr Thr. Phe Thr Asp Tyr

20 25 30
Ala Met His Trp Val Arg Leu Ala Pro Gly Gln Gly Leu Glu Trp Ile

35 40 45
Gly Val Ile Ser Thr Tyr Tyr Gly Asn Thr Asn Tyr Asn Gln Lys Phe

50 55 60
Lys Gly Arg Ala Thr Met Thr Val Asp Lys Ser Ile Ser Thr Ala Tyr 65 70 75 80

Met Glu Leu Ser Arg . Leu Arg Ser Asp Asp Thr Ala Val Tyr Tyr Cys
85 90 95

Ala Arg
<210 95
<211> 98
<212> PRT
<213> Sequência Artificial
<220>
<223> cadeia pesada de hu3H9 para sequência de 8G6HV2
<400> 95
Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala 1 5 10 15 Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Asp Tyr

20 25 30
Ala Met His Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Ile

35 40 45
Gly Val Ile Ser Thr Tyr Tyr Gly Asn Thr Asn Tyr Asn Gln Lys Phe

50 55 60
Lys Gly Arg Ala Thr Met Thr Val Asp Lys Ser Ile Ser Thr Ala Tyr 65 70 75 80

Met Glu Leu Ser Arg Leu Arg Ser Asp Asp Thr Ala Val Tyr Tyr Cys
85 90 95

Ala Arg
<210> 96
<211> 98
<212> PRT
<213> Sequência Artificial
<220>
<223> cadeia pesada de hu3H9 para sequência de 8G6HV3
<400> 96
Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala

1 5 10 15

Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Asp Tyr

20 25 30
Ala Met His Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Met

35 40 45
Gly Val Ile Ser Thr Tyr Tyr Gly Asn Thr Asn Tyr Asn Gln Lys Phe

50 55 60
Lys Gly Arg Ala Thr Met Thr Val Asp Lys Ser Ile Ser Thr Ala Tyr 65 70 75 80

Met Glu Leu Ser Arg Leu Arg Ser Asp Asp Thr Ala Val Tyr Tyr Cys
85 90 95

Ala Arg
<210> 97 <211> 76
<212> PRT
<213> Sequência Artificial
<220>
<223> cadeia pesada de hu3H9 para sequência de VH1-2
<400> 97
Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala

1 5 10 15

Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Trp Val

20 25 30
Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Met Gly Arg Val Thr Met

35 40 45
Thr Arg Asp Thr Ser Ile Ser Thr Ala Tyr Met Glu Leu Ser Arg Leu

50 55 60
Arg Ser Asp Asp Thr Ala Val Tyr Tyr Cys Ala Arg
65 70 75
<210> 98
<211> 99
<212> PRT
<213> Sequência Artificial
<220>
<223> cadeia leve de hu8H6 para sequência de murino
<400> 98
Asp Ile Val Leu Thr Gln Ser Pro Ala Ser Leu Ala Val Ser Leu Gly

1 5 10 15

Gln Arg Ala Ile Ile Ser Cys Arg Ala Ser Gln Ser Val Ser Thr Ser

20 25 30
Ser Tyr Ser Tyr Met Tyr Trp Tyr Gln Gln Lys Pro Gly Gln Ser Pro

35 40 45
Lys Phe Leu Ile Lys Tyr Ala Ser Asn Leu Glu Ser Gly Val Pro Ala

50 . 55 . 60
Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Asn Ile His 65 70 75 80

Pro Val Glu Glu Glu Asp Thr Ala Thr Tyr Tyr Cys Gln His Asn Trp
85 90 95

Glu Ile Pro
<210> 99
<211> 99
<212> PRT
<213> Sequência Artificial
<220>
<223> cadeia leve de hu8H6 para seqiiência de 8G6LV1
<400> 99
Asp Ile Val Leu Thr Gln Ser Pro Ala Thr Leu Ser Leu Ser Pro Gly

1. 5 10 15

Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gln Ser Val Ser Thr Ser

20 25 30
Ser Tyr Ser Tyr Met Tyr Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro

35 40 45
Arg Phe Leu Ile Lys Tyr Ala Ser Asn Leu Glu Ser Gly Ile Pro Ala

50 55 60
Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser 65 70 75 80

Ser Leu Glu Pro Glu Asp Phe Ala Val Tyr Tyr Cys Gln His Asn Trp
85 90 95

Glu Ile Pro
<210> 100
<211> 99
<212> PRT
<213> Sequência Artificial
<220>
<223> cadeia leve de hu8H6 para sequência de 8G6LV2
<400> 100
Glu Ile Val Leu Thr Gln. Ser Pro Ala Thr Leu Ser Leu Ser Pro Gly 1 5 10 15

Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gln Ser Val Ser Thr Ser

20 25 30
Ser Tyr Ser Tyr Met Tyr Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro

35 40 45
Arg Phe Leu Ile Lys Tyr Ala Ser Asn Leu Glu Ser Gly Ile Pro Ala

50 55 60
Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser 65 70 75 80

Ser Leu Glu Pro Glu Asp Phe Ala Val Tyr Tyr Cys Gln His Asn Trp
85 90 95

Glu Ile Pro
<210> 101
<211> 10
<212> PRT
<213> SeqOência Artificial
<220>
<223> cadeia pesada de hu8H6 para sequência de 8G6 de anticorpos <400> 101
Ser Tyr Thr Phe Thr Asp Tyr Ala Met His
1 5 10
<210> 102
<211> 10
<212> PRT
<213> Sequência Artificial
<220>
<223> cadeia pesada de CDR1 para sequência de 1A8 de anticorpos <400> 102
Ser Tyr Thr Phe Thr Asp Tyr Thr Met His
1 5 10
<210> 103
<211> 10 <212> PRT
<213> Sequência Artificial
<220>
<223> cadeia pesada de CDRl para sequência de 2B1 e 3GB anticorpos <400> 103
Gly Phe Thr Phe Ser Arg Tyr Val Met Ser
1 5 10
<210> 104
<211> 10
<212> PRT
<213> Sequência Artificial
<220>
<223> cadeia pesada de CDRl para sequência de 2A1 de anticorpos <400> 104
Gly Tyr Asp Phe Asn Asn Asp Leu lie Glu
1 5 10
<210> 105
<211> 10
<212> PRT
<213> Sequência Artificial
<220>
<223> cadeia pesada de CDRl para sequência de 2G2 de anticorpos <400> 105
Gly Tyr Ala Phe Thr Asn Tyr Leu lie Glu
1 5 10
<210> 106
<211> 17
<212> PRT
<213> Sequência Artificial
<220>
<223> cadeia pesada de CDR2 para sequência de 8G6 de anticorpos <400> 106 Val Ile Ser Thr Tyr Tyr Gly Asn Thr Asn Tyr Asn Gln Lys Phe Lys 1 5 10 15

Gly
<210> 107
<211> 17
<212> PRT
<213> Segtiência Artificial
<220>
<223> Cadeia pesada CDR2 de sequência para 1A8 anticorpos <400> 107
Val Ile Asp Thr Tyr Tyr Gly Lys Thr Asn Tyr Asn Gln Lys Phe Glu 1 5 10 15

Gly
<210> 108
<211> 16
<212> PRT
<213> Sequência Artificial
<220>
<223> Cadeia pesada CDR2 de sequência para 2B1 anticorpos <400> 108
Ser Ile Ser Ser Gly Gly Ser Thr Tyr Tyr Pro Asp Ser Val Lys Gly 1 5 10 15

<210> 109
<211> 16
<212> PRT
<213> Sequência Artificial
<220>
<223> Cadeia pesada CDR2 de sequência para 3G9 anticorpos <400> 109
Ser Ile Ser Ser Gly Gly Arg Met Tyr Tyr Pro Asp Thr Val Lys Gly 1 5 10 15

<210> 110 <211> 17
<212> PRT
<213> Sequência Artificial
<220>
<223> Cadeia pesada CDR2 de sequência para 2A1 anticorpos <400> 110
Val Ile Asn Pro Gly Ser Gly Arg Thr Asn Tyr Asn Glu Lys Phe Lys 1 5 10 15

Gly
<210> 111
<211> 17
<212> PRT
<213> Sequência Artificial
<220>
<223> Cadeia pesada CDR2 de sequência para 2G2 anticorpos <400> 111
Val Ile Ser Pro Gly Ser Gly Ile Ile Asn Tyr Asn Glu Lys Phe Lys 1 5 10 15

Gly
<210> 112
<211> 17
<212> PRT
<213> Sequência Artificial
<220>
<223> Cadeia pesada CDR3 de sequência para 8G6 anticorpos <400> 112
Gly Gly Leu Arg Arg Gly Asp Arg Pro Ser Leu Arg Tyr Ala Met Asp 1 5 10 15

Tyr

<210> 113
<211> 17 <212> PRT
<213> Sequência Artificial
<220>
<223> Cadeia pesada CDR3 de sequência para 1A8 anticorpos <400> 113
Gly Gly Phe Arg Arg Gly Asp Arg Pro Ser Leu Arg Tyr Ala Met Asp 1 5 10 . 15

Ser

<210>
<211> 12
<212> PRT
<213> Sequência Artificial
<220>
<223> Cadeia pesada CDR3 de sequência para 2B1 anticorpos <400> 114
Gly Ala lie Tyr Asp Gly Tyr Tyr Val Phe Ala Tyr
1 . 5 10
<210> 115
<211> 12
<212> PRT
<213> Sequência Artificial
<220>
<223> Cadeia pesada CDR3 de sequência para 3G9 anticorpos <400> 115
Gly Ser Ile.Tyr Asp Gly Tyr Tyr Val Phe Pro Tyr
1 5 10
<210> 116
<211> 12
<212> PRT
<213> Sequência Artificial
<220> <223> Cadeia pesada CDR3 de sequência para 2A1 anticorpos <400> 116
Ile Tyr Tyr Gly Pro His Ser Tyr Ala Met Asp Tyr
1 5 10
<210> 117
<211> 11
<212> PRT
<213> Sequência Artificial
<220>
<223> Cadeia pesada CDR3 de sequência para 2G2 anticorpos <400> 117
Ile Asp Tyr Ser Gly Pro Tyr Ala Val Asp Asp
1 5 . 10
<210> 118
<211> 15 ,
<212> PRT
<213> Sequência Artificial
<220>
<223> Cadeia leve de CDRl para sequência de8G6 anticorpos <400> 118
Arg Ala Ser Gln Ser Val Ser Thr Ser Ser Tyr Ser Tyr Met Tyr 1 5 10 15

<210> 119
<211> 15
<212> PRT
<213> Sequência Artificial
<220>
<223> Cadeia leve de CDRl para sequência delA8 anticorpos <400> 119
Arg Ala Ser Gln Ser Val Ser Ile Ser Thr Tyr Ser Tyr Ile His 1 5 10 15

<210> 120 <211> 12
<212> PRT
<213> Sequência Artificial
<220>
<223> Cadeia leve de CDRl para sequência de2Bl anticorpos <400> 120
Ser Ala Ser Ser Ser Val Ser Ser Ser Tyr Leu Tyr
1 5 10
<210> 121
<211> 12
<212> PRT
<213> Seqtíência Artificial
<220>
<223> Cadeia leve de CDRl para sequência de3G9 anticorpos <400> 121
Ser Ala Asn Ser Ser Val Ser Ser Ser Tyr Leu Tyr
1 5 10
<210> 122
<211> 11
<212> PRT
<213> Sequência Artificial
<220>
<223> Cadeia leve de CDRl para sequência de2Al anticorpos <400> 122
Lys Ala Ser Leu Asp Val Arg Thr Ala Val Alá
1 5 10
<210> 123
<211> 11
<212> PRT
<213> Sequência Artificial
<220>
<223> Cadeia leve de CDRl para sequência de2G2 anticorpos <400> 123
Lys Ala Ser Gln Ala Val Asn Thr Ala Val Ala
1 5 10
<210> 124
<211> 7
<212> PRT
<213> Sequência Artificial
<220>
<223> Cadeia leve de CDR2 de sequência para 8G6 e 1A8 anticorpos <400> 124
Tyr Ala Ser Asn Leu Glu Ser
1 5
<210> 125
<211> 7
<212> PRT
<213> Sequência Artificial
<220>
<223> Cadeia leve de CDRl para sequência de 2B1 de 3G9 anticorpos <400> 125
Ser Thr Ser Asn Leu Ala Ser
1 5
<210> 126
<211> 7
<212> PRT
<213> Sequência Artificial
<220>
<223> Cadeia leve de CDR2 de sequência para 2A1 anticorpos <400> 126
Ser Ala Ser Tyr Arg Tyr Thr
1 5
<210> 127
<211> 7 <212> PRT
<213> Sequência Artificial
<220>
<223> Cadeia leve de CDR2 de sequência paira 2G2 anticorpos <400> 127
Ser Ala Ser Tyr Gln Tyr Thr
1 5
<210> 128
<211> 9
<212> PRT
<213> Sequência Artificial
<220>
<223> Cadeia leve CDR3 de sequência para 8G6 anticorpos <400> 128
Gln His Asn Trp Glu Ile Pro Phe Thr
1 . 5
<210> 129
<211> 9
<212> PRT
<213> Seqíiência Artificial
<220>
<223> Cadeia leve CDR3 de sequência para 1A8 anticorpos <400> 129
Gln His Ser Trp Glu Ile Pro Tyr Thr
1 5
<210> 130
<211> 9
<212> PRT
<213> Sequência Artificial
<220>
<223> Cadeia leve CDR3 de sequência para 2B1 anticorpos <400> 130 His Gln Trp Ser Ser Tyr Pro Pro Thr
1 5
<210> 131
<211> 9
<212> PRT
<213> Sequência Artificial
<220>
<223> Cadeia leve CDR3 de sequência para 3G9 anticorpos <400> 131
His Gln Trp Ser Thr Tyr Pro Pro Thr
1 5
<210> 132
<211> 9
<212> PRT
<213> Sequência Artificial
<220>
<223> Cadeia leve CDR3 de sequência para 2A1 anticorpos <400> 132
Gln Gln His Tyr Gly lie Pro Trp Thr
1. 5
<210> 133
<211> 9
<212> PRT
<213> Sequência Artificial
<220>
<223> Cadeia leve CDR3 de sequência para 2G2 anticorpos <400> 133
Gln His His Tyr Gly Val Pro Trp Thr
1 5
<210> 134
<211> 99
<212> PRT <213> Sequência Artificial
<220>
<223> 8G6LV3 Cadeia leve para sequência de hu8G6
<400> 134
Glu Ile Val Leu Thr Gln Ser Pro Ala Thr Leu Ser Leu Ser Pro Gly

1 5 10 15

Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gln Ser Val Ser Thr Ser

20 25 30
Ser Tyr Ser Met Tyr Trp Tyr Gln Gln Lys Pro Gly Gln Ala PrO Arg

35 40 45
Ile Leu Leu Ile Lys Tyr Ala Ser Asn Leu Glu Ser Gly Ile Pro Ala

50 55 60
Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser 65 70 75 80

Ser Leu Glu Pro Glu Asp Phe Ala Val Tyr Tyr Cys Gln His Asn Trp
85 90 95

Glu Ile Pro

<210> 135
<211> 70
<212> PRT
<213> Sequência Artificial
<220>
<223> L6 Cadeia leve para sequência de hu8G6
<400> 135
Glu Ile Val Leu Thr Gln Ser Pro Ala Thr Leu Ser Leu Ser Pró Gly

1 5 10 15

Glu Arg Ala Thr Leu Ser Cys Trp Tyr Gln Gln Lys Pro Gly Gln Ala

20 25 30
Pro Arg Leu Leu Ile Tyr Gly Ile Pro Ala Arg Phe Ser Gly Ser Gly

35 40 45
Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Glu Pro Glu Asp 50 55 60
Phe Ala Val Tyr Tyr Cys
65 70
<210> 136
<211> 237
<212> PRT
<213> Sequência Artificial
<220>
<223> vetor pKJS195 - versão 3G9 de cadeia leve 5
<400> 136
Met Asp Phe Gln Val Gln Ile Phe Ser Phe Leu Leu Ile Ser Val Ser

1 5 10 15

Val Ile Met Ser Arg Gly Glu Ile Val Leu Thr Gln Ser Pro Ala Thr

20 25 30
Leu Ser Leu Ser Pro Gly Glu Arg Ala Thr Leu Ser Cys Ser Ala Ser

35 40 45
Ser Ser Val Ser Ser Ser Tyr Leu Tyr Trp Tyr Gln Gln Lys Pro Gly

50 55 60
Gln Ala Pro Arg Leu Leu Ile Tyr Ser Thr Ser Asn Leu Ala Ser Gly 65 70 75 80

Ile Pro Ala Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu
85 90 95

Thr Ile Ser Ser Leu Glu Pro Glu Asp Phe Ala Val Tyr Tyr Cys His

100 105 110
Gln Trp Ser Thr Tyr Pro Pro Thr Phe Gly Gly Gly Thr Lys Val Glu

115 120 125
Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser

130 135 140
sp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn 145 150 155 160 sn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala
165 170 175 Leu Gln Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln Asp Ser Lys

180 185 190
Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp

195 200 205
Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu

210 215 220
Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys
225 230 235
<210> 137
<211> 468
<212> PRT
<213> Sequência Artificial
<220>
<223> pKJS189 vector - 3G9 vector 3 cadeia pesada
<400> 137
Met Asp Phe Gly Leu Ser Trp Val Phe Leu Val Leu Val Leu Lys Gly

1 5 10 15

Val Gln Cys Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln

20 25 30
Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe

35 40 45
Ser Arg Tyr Val Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu

50 55 60
Glu Trp Val Ala Ser Ile Ser Ser Gly Gly Arg Met Tyr Tyr Pro Asp 65 70 75 80

Thr Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser
85 90 95

Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr

100 105 110
Tyr Cys Ala Arg Gly Ser Ile Tyr Asp Gly Tyr Tyr Val Phe Pro Tyr

115 120 125
Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly 130 135 140
Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly 145 150 155 160

Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val
165 170 175

Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe

180 185 190
Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val

195 200 205
Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr He Cys Asn Val

210 215 220
Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys 225 230 . 235 240

Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu
245 250 255

Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr

260 265 : 270
Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val

275 280 285
Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val

290 295 300
Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser 305 310 315 320

Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu
325 330 335

Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala

340 345 350
Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly. Gln Pro Arg Glu Pro

355 360 365
Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln

370 , 375 380
Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala 385 390 395 400

Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr
405 410 415

Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu

420 425 430
Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser

435 440 445
Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser

450 455 460
Leu Ser Pro Gly
465
<210> 138
<211> 468
<212> PRT
<213> SegUência Artificial
<220>
<223> vetor pKJS 196 - cadeia pesada versão 3 aglicosil 369 <400> 138
Met Asp Phe Gl Leu Ser Trp Val Phe Leu Val Leu Val Leu Lys Gly

1 5 10 . 15

Val Gln Cys Glu Val . Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln

20 25 30
Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe

35 40 45
Ser Arg Tyr Val Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu

50 55 60
Glu Trp Val Ala Ser Ile Ser Ser Gly Gly Arg Met Tyr Tyr Pro Asp 65 70 75 80

Thr Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser
85 90 95

Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr 100 105 110 Tyr Cys Ala Arg Gly Ser lie Tyr Asp Gly Tyr Tyr Val Phe Pro Tyr

115 120 125
Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly 130 135 140
. Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly 145 150 155 160

Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val
165 170 175

Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe

180 185 190
Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val

195 200 205
Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr lie Cys Asn Val

210 215 220
Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys 225 230 235 240

Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu
245 250 255

Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr

260 265 270
Leu Met lie Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val

275 280 285
Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val

290 295 300
Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Gln Ser 305 310 315 320

Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu
325 330 335

Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala

340 345 350
Pro lie Glu Lys Thr lie Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro 355 360 365 Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln

370 375 380
Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp lie Ala 385 390 395 400

Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr
405 410 415

Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu

420 425 430
Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser

435 440 445
Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser

450 455 460
Leu Ser Pro Gly
465
<210> 139
<211> 108
<212> PRT
<213> Sequência Artificial
<220>
<223> cadeia leve de hu3G9 versão 1
<400> 139
Glu lie Val Leu Thr Gln Ser Pro Ala Thr Leu Ser Leu Ser Pro Gly

1 5 10 15

Glu Arg Ala Thr Leu Ser Cys Ser Ala Ser Ser Ser Val Ser Ser Ser

20 25 30
Tyr Leu Tyr. Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Arg Leu Trp

35 40 45
lie Tyr Ser Thr Ser Asn Leu Ala Ser Gly Val Pro Val Arg Phe Ser

50 55 . 60
Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr lie Ser Ser Leu Glu 65 70 75 80

Pro Glu Asp Phe Ala Val Tyr Phe Cys His Gln Trp Ser Thr Tyr Pro 85 90 95

Pro Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys
100 105
<210> 140
<211> 108
<212> PRT
<213> Sequência Artificial
<220>
<223> cadeia leve de hu3G9 versão 2
<400> 140
Glu Ile Val Leu Thr Gln Ser Pro Ala Thr Leu Ser Leu Ser Pro Gly

1 5 10 15

Glu Arg Ala Thr Leu Ser Cys Ser Ala Ser Ser Ser Val Ser Ser Ser

20 25 30
Tyr Leu Tyr Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Arg Leu Trp

35 40 45
Ile Tyr Ser Thr Ser Asn Leu Ala Ser Gly Val Pro Ala Arg Phe Ser

50 55 60
Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Glu 65 70 75 80

Pro Glu Asp Phe Ala Val Tyr Tyr Cys His Gln Trp Ser Thr Tyr Pro
85 90 95

Pro Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys
100 105
<210> 141
<211> 108
<212> PRT
<213> Sequência Artificial
<220>
<223> cadeia leve de hu3G9 versão 3
<400> 141
Glu Ile Val Leu Thr Gln Ser Pro Ala Thr Leu Ser Leu Ser Pro Gly 1 5 10 15

Glu Arg Ala Thr Leu Ser Cys Ser Ala Ser Ser Ser Val Ser Ser Ser

20 25 30
Tyr Leu Tyr Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Arg Leu Tr

35 40 45
lie Tyr Ser Thr Ser Asn Leu Ala Ser Gly lie Pro Ala Arg Phe Ser

50 55 60
Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr lie Ser Ser Leu Glu 65 70 75 80

Pro Glu Asp Phe Ala Val Tyr Tyr Cys His Gln Trp Ser Thr Tyr Pro
85 . 90 95

Pro Thr Phe Gly Gly Gly Thr Lys Val Glu lie Lys
100 105
<210> 142
<211> 108
<212> PRT
<213> Sequência Artificial
<220>
<223> cadeia leve de hu3G9 versão 4
<400> 142
Gln lie Val Leu Thr . Gln Ser Pro Ala Thr Leu Ser Leu Ser Pro Gly

1 5 10 5

Glu Arg Ala Thr Leu Ser Cys Ser Ala Ser Ser Ser Val Ser Ser Ser

20 25 30
Tyr Leu Tyr Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Arg Leu Trp

35 , 40 45
lie Tyr Ser Thr Ser Asn Leu Ala Ser Gly lie Pro Ala Arg Phe Ser

50 55 60
Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr lie Ser Ser Leu Glu 65 70 75 80

Pro Glu Asp Phe Ala Val Tyr Tyr Cys His Gln Trp Ser Thr Tyr Pro
85 90 95 Pro Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys
100 105
<210> 143
<211> 108
<212> PRT
<213> Sequência Artificial
<220>
<223> hu versão 3G9 de cadeia leve 5
<400> 143
Glu Ile Val Leu Thr Gln Ser Pro Ala Thr Leu Ser Leu Ser Pro Gly

1 5 10 15

Glu Arg Ala Thr Leu Ser Cys Ser Ala Ser Ser Ser Val Ser Ser Ser

20 25 30
Tyr Leu Tyr Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Arg Leu Leu

35 40 45
Ile Tyr Ser Thr Ser Asn Leu Ala Ser Gly Ile Pro Ala Arg Phe Ser . 50 55 60
Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Glu 65 70 75 80

Pro Glu Asp Phe Ala Val Tyr Tyr Cys His Gln Trp Ser Thr Tyr Pro
85 90 95

Pro Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys
100 105
<210> 144
<211> 120
<212> PRT
<213> Sequência Artificial
<220>
<223> cadeia pesada de hu3G9 versão 1
<400> 144
Glu Val Met Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Arg Tyr

20 25 30
Val Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val

35 40 45
Ala Ser Ile Ser Ser Gly Gly Arg Met Tyr Tyr Pro Asp Thr Val Lys

50 55 60
Gly Arg Phe Thr Ile Ser Arg Asp Ser Ala Lys Asn Ser Leu Tyr Leu 65 70 75 80

Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala
85 90 95

Arg Gly Ser Ile Tyr Asp Gly Tyr Tyr Val Phe Pro Tyr Trp Gly Gln

100 105 110
Gly Thr Leu Val Thr Val Ser Ser
115 120
<210> 145
<211> 120
<212> PRT
<213> Sequência Artificial
<220>
<223> cadeia pesada de hu3G9 versão 2
<400> 145
Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly

1 5 10 15

Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Arg Tyr

20 25 30
Val Met Ser. Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val

35 40 45
Ala Ser Ile Ser Ser Gly Gly Arg Met Tyr Tyr Pro Asp Thr Val Lys

50 55 60
Gly Arg Phe Thr Ile Ser Arg Asp Ser Ala Lys Asn Ser Leu Tyr Leu 65 70 75 80

Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala 85 90 95

Arg Gly Ser Ile Tyr Asp Gly Tyr Tyr Val Phe Pro Tyr Trp Gly Gln

100 105 110

Gly Thr Leu Val Thr Val Ser Ser
115 120
<210> 146
<211> 120
<212> PRT
<213> Sequência Artificial
<220>
<223> cadeia pesada de hu3G9 versões 3 e 5
<400> 146
Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly

1 5 10 15

Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Arg Tyr

20 25 30
Val Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val

35 40 45
Ala Ser Ile Ser Ser Gly Gly Arg Met Tyr Tyr Pro Asp Thr Val Lys

50 55 60
Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr Leu 65 70 75 80

Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala
85 90 95

Arg Gly Ser Ile Tyr Asp Gly Tyr Tyr Val Phe Pro Tyr Trp Gly Gln

100 105 no
Gly Thr Leu Val Thr Val Ser Ser
115 120
<210> 147
<211> 20
<212> DNA
<213> Sequência Artificial <220>
<223> Iniciador oligonucleotídeo usado amplificar oligonucleotídeo de molde padrão
<400> 147
catggccttc cgtgttccta 20 <210> 148
<211> 16
<212> DNA
<213> Sequência Artificial
<220>
<223> iniciador oligonucleotídeo usado amplificar oligonucleotídeo de molde padrão
<400> 148
gcggcacgtc agatcc 16 <210> 149
<211> 16
<212> DNA
<213> Seqíiência Artificial
<220>
<223> sonda para GADPH reconhecido
<400> 149
ccccaatgtg tccgtc 16 <210> 150
<211> 40
<212> DNA
<213> Sequência Artificial
<220>
<223> Iniciador PCR usada para amplificar o primeiro filamento de RNA <400> 150
ggccagtgaa ttgtaatacg actcactata gggaggcggt 40

<210> 151 <211> 11
<212> PRT
<213> Sequência Artificial
<220>
<223> FR4 humano derivado de uma sequência consenso estrutural

<400> 151
Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser
1 5 10
<210> 152
<211> 10
<212> PRT
<213> Sequência Artificial
<220>
<223> FR4 humano derivado de uma sequência consenso estrutural

<400> 152
Phe Gly Gly Gly Thr Lys Val Glu Ile Lys
1 5 10