Processing

Please wait...

Settings

Settings

Goto Application

1. WO2020139116 - RECOMBINANT INHIBITOR OF HIV ENTRY

Note: Text based on automatic Optical Character Recognition processes. Please use the PDF version for legal matters

[ RU ]

Рекомбинантный ингибитор проникновения ВИЧ.

Область техники, к которому относится изобретение.

Изобретение относится к области биотехнологии, в частности к получению рекомбинантного пептида пролонгированного действия, ингибирующего слияние ВИЧ с клеткой.

Предшествующий уровень техники.

Проблема ВИЧ-инфекции в России в последнее время стоит особенно остро. Общее число россиян, инфицированных ВИЧ, зарегистрированных в Российской Федерации на 31 декабря 2015 г., достигло 1 006 388 человек. Из них умерло по разным причинам 212 579 ВИЧ-инфицированных, в т.ч. 27 564 в 2015 году (что на 12,9% больше, чем в 2014 г.) К сожалению, до сих пор не существует эффективных средств профилактики и лечения ВИЧ-инфекции. До настоящего времени не удалось разработать вакцину против ВИЧ, способную индуцировать нейтрализующие антитела и устойчивый клеточный иммунитет. Для борьбы с ВИЧ-инфекцией остается только возможность терапии уже инфицированных субъектов.

Современная терапия ВИЧ основана на двух типах препаратов: ингибиторах обратной транскриптазы и ингибиторах протеазы. Эти препараты действуют в клетке, в которую уже проник ВИЧ [HTV-1 Antiretroviral Drug Therapy. Cold Spring Harb Perspect Med. 2012

Apr; 2(4): a007161. doi: 10.1101/cshperspect.a007161]. Препараты являются высокотоксичными, имеют много побочных эффектов и вызывают лекарственную устойчивость. Лекарственная устойчивость связана с высокой частотой появления мутаций, которые могут быть введены благодаря низкой точности работы вирусной обратной транскриптазы. Число возможных мутаций составляет 2-5x105 в одном цикле репликации, что приводит к изменению до 40% аминокислотных последовательностей белков, кодируемых вирусными генами. Кроме лекарственной устойчивости, ингибиторы вирусной обратной транскриптазы вызывают такие эффекты как подавление функции спинного мозга, нарушение функции печени, воспаление поджелудочной железы и различные заболевания периферической нервной системы. Лекарственная устойчивость и токсичность также являются важной проблемой и для ингибиторов вирусной протеазы.

Таким образом, существует необходимость в поиске новых лекарственных средств, характеризующихся большей эффективностью и меньшей токсичностью. Значительные усилия направлены на поиск таких лекарственных средств, которые действуют на ранних этапах вирусной инфекции и препятствуют проникновению ВИЧ в клетку. В идеале такие препараты смогут заменить не существующую вакцину против ВИЧ

Антитела к клеточным рецепторам ВИЧ, таким как CD4, и CCR5, могут блокировать сцепление белка gpl20 с клеточными мембранами, ограничивая проникновение ВИЧ в клетку. Ibalizumab TaiMed Biologies Inc, UB-421 Шйе юШ к?а1,

Ш CD4, PRO- 140 CytoDyn CCR5,

Процесс слияния ВИЧ с клеткой контролируется белком gp41 оболочки ВИЧ.

Пептиды, копирующие N- и С- концевые последовательности эктодомена gp41 могут конкурировать с такими же последовательностями ВИЧ и тем самым ингибировать

10 процесс слияния и проникновения вируса в клетку. Изучение механизма проникновения

ВИЧ в клетку привело к разработке нового класса антивирусных препаратов, названных ингибиторами слияния. Такой вид терапии приводит к снижению вирусной нагрузки

15 ниже детектируемого уровня [Entry inhibitors and their use in the treatment of HIV-1 infection. Antiviral Res. 2013 May;98(2): 158-70. PMID: 23541872 doi:

10.1016/j .antiviral.2013.03.017] . Из уровня техники известен единственный разрешенный к

2Q применению препарат, ингибиторующий слияние - пептид Fuzeon® (энфувиртид) или Т- 20. Fuzeon представляет собой синтетический пептид, длиной в 34 аминокислотных остатка, копирующий С-концевой фрагмент эктодомена gp41, непосредственно примыкающий к мембране вирусной частицы. Пептидный ингибитор слияния действует 25

на клеточной мембране, не проникая в клетку , поэтому он обладает минимальным набором побочных эффектов, в отличие от препаратов, действующих на поздних этапах

ВИЧ инфекции и которые необходимо вводить внутрь клеток пациентов. Высоко п консервативная последовательность С-концевой части эктодомена ВИЧ позволяет предположить отсутствие лекарственной устойчивости в процессе терапии. В отличие от ингибиторов обратной траскриптазы и ингибиторов протеазы ВИЧ, применяемых в

35 настоящее время в клинической практике, ингибитор слияния Fuzeon обладает более высокой эффективностью, низкой токсичностью и отсутствием лекарственной устойчивости. Однако у Fuzeon имеется ряд недостатков. Во-первых, аминокислотная

40 последовательность Fuzeon не оптимальна для ингибирования слияния, поэтому препарат эффективен не для всех изолятов ВИЧ [Genetic Pathway of HTV-1 Resistance to Novel

Fusion Inhibitors Targeting the Gp41 Pocket. J Virol. 2015 Dec;89(24): 12467-79. doi:

^ 10.1 128/JVI.01741-15], для ингибирования большинства изолятов требуются высокие концентрации пептида. Во-вторых, Fuzeon нестабилен при введении пациентам, имеет плохую фармакокинетику. Требуются высокие ежедневные дозы, равные 200 мг в сутки, что вызывает некоторые местные реакции у ряда пациентов, что ограничивает его 50

применение [Localized Amyloidosis at the Site of Enfuvirtide Injection. Ann Intern Med. 2009;151(7):515-516. doi: 10.7326/0003-4819-151 -7-200910060-00017].

Создание новых препаратов, обладающих большей специфичностью и стабильностью по сравнению с Fuzeon. является актуальной задачей.

В патенте US 8,629,101 В2 описывается способ получения путем конъюгации с холестериновыми производными пептида C34-PEG-Chol - ингибитора слияния ВИЧ с клеткой пролонгированного действия. Такие производные обладают сродством к холестериновым кластерам клеточных мембран, что способствует их депонированию и 1П

повышает биологическую активность. Однако результаты первой фазы клинических исследований показали, что подобные производные сорбируются в месте введения, плохо рассасываются и не распределяются равномерно по всему организму, что препятствует 15 их дальнейшему использованию.

В заявке на патент RU2016143415 описан рекомбинантный пептид ингибитор слияния ВИЧ, содержащий аминокислотную последовательность, обеспечивающую его 20 сродство с мембраной. В качестве такой последовательности использовали мотив CRAC (Cholesterol Recognition Amino acid Consensus), чьи консенсусные последовательности содержат мотив Leu/Val-X(l-5)-Tyr-X(l-5)-Arg/Lys. Для того чтобы уменьшить ^ вероятность образования анти-пептидных антител, фрагмент было предложено брать из последовательностей человеческих белков. К сожалению, такие последовательности у человека находятся в трансмембранных фрагментах белков. Экспрессия трансмембранных последовательностей млекопитающих в клетках E.coli происходит с 30 очень низким выходом. Сами такие белки плохо растворимы в водных буферных системах, что усложняет очистку и получение готовой лекарственной формы для инъекций. Плохой выход и трудности выделения неизбежно повышают себестоимость 35 конечного продукта.

Описание сущности изобретения.

Настоящее изобретение относится к ингибиторам слияния ВИЧ, обладающим

40 высокой устойчивостью в организме и высоким потенциалом лечения ВИЧ-инфекции. По сравнению с Т-20 ингибитор слияния согласно настоящему изобретению обладает более низкими дозами введения и как следствие этого, более низкой токсичностью.

Заявителями получен пептид SEQ ID: 1, способный ингибировать проникновение 45

ВИЧ в клетки:

QAANNTTWTEWDRELNNLTSLLHSLIEELQNLQEKLAVLEVQLKKLIEELETLKDILSPL

TCGGGSGGGKEAYSLGGGSGGGREAYRV

50 Рекомбинантный пептид получен путем экспрессии в клетках E.coli, разработаны методики очистки данного продукта. Разработанный пептид обладает улучшенной

фармакокинетикой и более эффективно ингибирует слияние ВИЧ с клеткой-мишенью, чем ингибитор слияния Fuzeon.

Рекомбинантный пептид имеет уникальную структуру и содержит три функциональные области: область, гомологичную CHR gp41 ВИЧ, область тримеризации и область,

5

обеспечивающую сродство с мембраной клетки.

Для увеличения устойчивости вторичной и третичной структуры пептида использована последовательность лейциновой молнии. Лейциновая молния (leucine zipper) является 10 общим трехмерным структурным мотивом в белках и имеет такое название потому, что . лейцины находятся в каждом седьмом положении аминокислотного фрагмента, составляя тем самым домен образования суперспирали из двух альфа-спиралей. Такие 15 структуры присутствуют и прокариотах и в эукариотах и являются одним из важнейших элементов белок-белковых взаимодействий. Соединение двух последовательностей - CHR gp41 ВИЧ leucine zipper увеличивает устойчивость альфа-спирали полученного 20 пептида.

Изучение связывания белков с холестерином в клеточных мембранах привело к установлению нескольких возможных аминокислотных последовательностей,

^ взаимодействующих с холестерином клеточных мембран. Относительно недавно была установлена холестерин-связывающая аминокислотная последовательность, имеющая мотив, обратный CRAC и содержащая консенсусную последовательность Arg/Lys-X(l-5)- Tyr/Phe-X(l-5)-Leu/Val). Существует множество таких последовательностей, узнающих 30

мембранный холестерин и любая из них может быть использована в предлагаемой последовательности ингибитора проникновения ВИЧ.

Как неожиданно обнаружили авторы настоящего изобретения, последовательности

35 CARC, в отличие от последовательностей CRAC, не оказывают токсического действия на клетки E.coli и рекомбинантные белки, содержащие такие последовательности, могут быть экспрессированы с очень высоким выходом. Вторым важным преимуществом

40 последовательностей CARC являтся их нахождение в структурах растворимых человеческих белков, поэтому рекомбинантные белки, несущие CARC, обладают хорошей растворимостью в водных буферных системах. Это является важным фактором для разработки инъекционной лекарственной формы, содержащей такие пептиды.

45

Разработанный пептид существует в виде димера, стабилизированного дисульфидной связью между остатками цистеинов двух параллельных последовательностей лейциновой молнии, поэтому димер стабилен в организме после введения. Стабилизация димера 50

дисульфидной связью приводит к двух-центровому взаимодействию с фрагментом ВИЧ в предфьюзионной конформации, что усиливает биологическую активность пептида.

Биологическая активность ингибиторов проникновения ВИЧ связана с взаимодействием с N концевым фрагментом экто домена gp4l и конкуренцией с CHR за образование шести-членного шипа 6НВ. Возможность разработанного пептида взаимодействовать с образованием 6 НВ была оценена электрофорезом комплексов пептидов в нативном полиакриламидном геле.

На стабильность пептида HTVPGC в организме оказывает влияние и его холестерин связывающая область. Данная область обеспечивает обратимое связывание пептида с кластерами холестерина клеточных мембран, способствуя обратимому депонированию пептида, улучшая его фармакокинетику. Период полувыведения Т1/2 для

PGC составляет 68 часов и превышает таковой у Fuzeon (Т1/2 Fuzeon 0,65 часа) более чем в сто раз. Разработанное средство можно будет вводить один раз в неделю, а не дважды в день, как Т-20. Кластеры холестерина являются преимущественным участком прикрепления ВИЧ. Таким образом, на мембране клетки-мишени в месте прикрепления ВИЧ достигается локальное увеличение концентрации пептида-ингибитора, что дополнительно способствует усилению его биологической активности. Рекомбинантный пептид имеет биологическую активность (ингибирование слияния ВИЧ), значительно превышающую таковую у пептида Fuzeon, В экспериментах по изучению ингибирования слияния получены данные: IC90 (пептид HIVPGC) = 55 рМ, IC90 (Fuzeon) = 16 пМ, разработанный пептид более чем в сто раз более активен, чем пептид Т-20. Дневная доза

Fuzeon составляет 180 мг при двух кратном введении, приведенные данные по фармакокинетики и активности позволяют предположить, что разработанное средство можно будет вводить раз в неделю в дозе не более 10 мг.

Техническим результатом, достигаемым при реализации данного изобретения, является повышение эффективности терапии ВИЧ-инфекции, уменьшение дозы введения и частоты инъекций при курсовом лечении.

Описание фигуры чертежей.

Фиг. 1. Аминокислотная последовательность пептида PGCHIV (SEQ ID NO:1).

Пептид HIVPGC содержит область, гомологичную CHR gp41 ВИЧ (подчеркнуто), тримеризующий фрагмент (выделено курсивом) и два фрагмента, обеспечивающих сродство с мембраной клетки (выделено жирным).

Фиг. 2. Электрофорез в нативных условиях пептида PGCHIV (дорожка 1) и комплекса PGCHIV с N-концевым пептидом gp41 (дорожка 2). Стрелкой отмечен 6НВ.

Раскрытие лучшего варианта осуществления изобретения:

Пример 1. Получение рекомбинантного пептида PGCHIV.

Для получения рекомбинантного белка была создана генетическая конструкция на основе плазмиды pBR322, которая содержит ген, кодирующий данный рекомбинантный пептид (SEQ ID NO 2) под контролем lac UV5 промотора.

Плазмидой трансфецировали клетки E.coli штамма С600, трансформированные клетки рассевали на чашку Петри с LB-агаром, содержащим 100 мг/мл ампицшшна и инкубировали 16 часов при 37С. 8 единичных колоний инкубировали 10 часов в 1 мл LB, содержащим 100 мг/мл ампицилина. По 50 мкл культур клеток вносили в 0,5мл LB, содержащим 100 мг/мл ампицилина, инкубировали 2 часа и индуцировали экспрессию о

белка добавлением IPTG до 1 тМ.. Наличие рекомбинантного пептида анализировали электрофорезом в ПААГ. Два-три клона, продуцирующий наибольшее количество рекомбинантного пептида, пересевали в культуральную колбу с 200 мл LB, содержащим 5 100 мг/мл ампицилина. Культура выращивалась на шейкере при 280 об/мин при температуре 37С до достижения оптической плотности значения OD600=1,5QE.

Индукция экспрессии белка проводилась добавлением IPTG до концентрации 1тМ. Q Культура дополнительно культивировалась 4 часа, далее клетки лизировали в 8М мочевине и обрабатывали на ультразвуковом дезинтеграторе. Лизат клеток центрифугировали при 20000g 2 часа. Супернатант фильтровали через колонку с Q-s Sepharose. Фракцию, не связавшуюся с данным сорбентом, кроматографировали на SP- Sepharose в градиенте NaCl (стартовый буфер: 20 mM TrisHCl рН6.8, 20 mM NaCl, итоговый буфер 20 mM TrisHCl рН6.8, 400 mM NaCl).

Пример 2. Изучение фармакокинетики рекомбинантного пептида PGCHIV.

0

Аутбредным крысам Wistar, самцам (две группы по 4 особи) вводили подкожно рекомбинантный пептид и препарат Fusion, меченые J 125.

В сыворотке крови определяли количество введенных пептидов. По полученным данным 5 строили фармакокинетическую кривую. Определяли следующие параметры: Т (период полувыведения), AUC (площадь под кривой), Ке] (константа скорости элиминации).

Таблица 1. Фармакокинетические данные пептида PGCHIV

0

5


0

Результаты исследования свидетельствуют о том, что при подкожном введении

разработанный рекомбинантный пептид PGCHIV стабильнее препарата Fusion более чем в сто раз.

Пример 3. Изучение биологической активности (образование 6НВ) рекомбинантного пептида PGCHIV.

Рекомбинантный пептид PGCHIV и 36-членный N-концевой пептид смешивали в эквимолярном соотношении по 100 мкМ каждого и инкубировали 60 минут при 37 °С. Смесь разделяли в нативном 15% ПААТ, окрашивали кумаси R250. Результат показан на Фиг.2. Дорожка 1- пептид PGCHIV, дорожка 2 -разделение реакционной смеси. Стрелкой показана полоса соответствующая 6НВ. Видно, что рекомбинантный пептид PGCHIV эффективно взаимодействует с N- концевым фрагментом gp41.

Пример 4. Изучение биологической активности (ингибирования проникновения ВИЧ) рекомбинантного пептида PGCHTV.

Для тестирования пептидов в инфекционных тестах ВИЧ-1 мы создали пермессивную клеточную линию человека НЕК 293Т. Т.к. CXCR4 экспрессируется на этих клетках на низком уровне иэто вполне достаточно для вхождения Х4-тропного вируса в клетку, то мы стабильно экспрессировали только 2 молекулы - CD4 и CCR5. Лентивирусные конструкции pUCHR-CD4-IRES-puroH pUCHR-CCR5-IRES-zeo6bnra созданы путем амплификации генов из кДНК лимфоцитов человека и клонирования их в указанные выше конструкции по сайтам рестрикции ЕсоШи Xmal. Праймеры для ПЦР-амплификации генов были следующие:

5’-EcoRI-CD4: cGAATTCgccaccATGAACCGGGGAGTCCCTTTTAG

3’-XmaI-CD4: gCCCGGGTCAAATGGGGCTACATGTCTTC

5’-EcoRI-CCR5: cGAATTCgccaccATGGATTATCAAGTGTCAAGTCC

3’-XmaI-CCR5 : gCCCGGGTCACAAGCCCACAGATATTTCC

За основу эксперимента взят метод одноцикловой репликации ВИЧ- 1 , где инфекция измеряется по активности люциферазы с помощью так называемых репликационно-зависимых векторов с геном-репортером, разорванным интроном и гамма-глобина человека, как описано в публикациях (Mazurov et al. PloS Pathogens 2010 и Shunaeva et al. JVirol 2015). Преимущества метода заключаются в том, что можно ставить одноэтапный тест трансфекции/инфекции без необходимости выделения вирусоподобных частиц, а также нулевая фоновая активность люциферазы.

Варианты инфекции:

1. One step transfection/infection assay. 293T-CD4-CCR5 клетки в 12 луночном планшете трансфецируют тремя плазмидами: упаковочная pCMV-A8.2R 0,6 mkg, pUCHR-inLuc-mR 0,9 mkg, Env expression plasmid 0,2 mkg. Через 6 часов среду меняют на свежую, в '

опытные лунки добавляют пептид. Результаты инфекции регистрируют через 48-56 часов от момента трансфекции. Для этого клетки лизируют в Glolysisbuffer (Promega), добавляют BrightGlo luciferase reagent (Promega) и измеряют активность люциферазы на приборе GloMax 20/20 (Promega).

2. Cell-free НГУ-1 infection assay. 293Тклеткив 6 см чашке Петри ко-трансфецируют pCMV-A8.2R 2mkg, pUCHR-inLuc-mR3mkg, Envexpressionplasmid

(однаизприведенныхвьппе) 0,8mkg, через 6 часов среду меняют, а через 48 часов от момента трансфекции супернатант с VLP собирают, фильтруют через 0.45 мкм фильтр и замораживают. Полученные VLPs в разных дозах титруют, путем добавления к пермессивным клеткам 293T-CD4-CCR5. Для оценки ингибирующей активности пептидов их предварительно смешивают с VLPs в разных концентрациях

(преинкубируют в течение 1 часа при 37С) или сразу добавляют к клеткам-мишеням. Через 48 часов после инфицирования клетки лизируют и измеряют люциферазную активность, как описано выше.

3. Cell coculture НГУ-1 infection in human lymphoid cells. Для тестирования инфекции ВИЧ с Env из NL4-3 (CXCR4-TponHoro вируса) не нужно создавать пермисивную клеточную линию. Для постановки теста 1 млн Т-клеток человека СЕМ (эффекторы) трансфецируют pCMV-A8.2R 2 mkg, pUCHR-inLuc-mR 3 mkg, Env 0,8 mkg путем электропорации с помощью прибора Neon(Invitrogen). Через 5-6 часов клетки отмывают и смешивают с клетками-мишенями Raji/CD4 (в этот момент добавляют пептид). Инфекцию измеряют по люциферазной активности через 48-56 часов после смешивания клеток, как описано выше

Результаты представлены в Таблице 2.

Таблица 2. Ингибирование проникновение ВИЧ пептидами PGCHIV и Fusion (Т-20)


Результаты исследования свидетельствуют о том, что разработанный рекомбинантный пептид ингибирует проникновение ВИЧ значительно активнее препарата Fusion.