Einige Inhalte dieser Anwendung sind momentan nicht verfügbar.
Wenn diese Situation weiterhin besteht, kontaktieren Sie uns bitte unterFeedback&Kontakt
1. (WO2018229259) ENZYMPRODUKT MIT BETA-GALAKTOSIDASE
Anmerkung: Text basiert auf automatischer optischer Zeichenerkennung (OCR). Verwenden Sie bitte aus rechtlichen Gründen die PDF-Version.

Enzymprodukt mit beta-Galaktosidase

B es c h re i b u n g

Die vorliegende Erfindung betrifft ein Enzymprodukt umfassend ein beta-Galaktosidaseprodukt gemäß dem unabhängigen Anspruch 1 sowie ein Enzymprodukt erhältlich durch eine neutrale beta-Galaktosidase gemäß dem unabhängigen Anspruch 6.

Stand der Technik

Die Erfindung liegt auf dem Gebiet der Produktion einer Laktase zur Herstellung laktosefreier Produkte, die weder einen störenden Eigengeschmack noch einen störenden Eigengeruch haben.

Bei der Herstellung von Lebensmitteln werden seit Jahrhunderten enzymatische Prozesse verwendet. Eines der ältesten dieser enzymatischen Herstellungsverfahren ist die Produktion von Käse aus Milch, die ohne das Enzym Chymosin, das aus Rinderkälbermägen extrahiert wird, nicht möglich wäre. Das Enzym Chymosin, auch Lab genannt, bezeichnet man als Gerinnungsenzym.

Gerinnungsenzyme oder Koagulanzien wurden inzwischen auch in den Mägen anderer Säugetiere aber auch in Mikroorganismen wie Rhizumucor mihei, Rhizomucor pussilus oder Cryphonectria parasitica entdeckt. Inzwischen werden die Gerinnungsenzyme aus Säugetieren mit Hilfe mikrobieller Produktionsstämme wie Pilzen, z. B. Aspergillus oryzae, oder Hefen, z.B. Kluyveromyces lactis (K. lactis), produziert.

Im Laufe der Jahre haben mehr und mehr Enzyme Verwendung bei der Herstellung von Milchprodukten gefunden. Lysozym aus Hühnereiern wird als antimikrobieller Schutz verwendet. Phospholipasen verbessern die Ausbeute in der Käseherstellung, sowie den Geschmack des Käses. Lipasen mikrobiellen Ursprungs werden zur Verbesserung des Käsegeschmacks eingesetzt. Enzyme werden auch zur Herstellung von Laktobionsäure aus Laktose (Milchzucker) verwendet.

Laktasen sind besonders wichtige Hilfsstoffe für die milchverarbeitende Industrie. Laktasen oder beta-Galaktosidasen (EC 3.2.1.108) sind Enzyme, die den Milchzucker Laktose, ein Disaccharid, in seine Monosaccharide, Glukose und Galaktose, spalten. Laktasen werden sowohl zur Herstellung bestimmter Milchprodukte, wie Dulce de Leche, als auch zur Entfernung von Laktose aus Milch eingesetzt.

Durch eine Behandlung mit Laktase kann die Laktose aus Milch entfernt werden. Die dabei entstehenden laktosefreien Milchprodukte können von laktoseintoleranten Verbrauchern ohne die unangenehmen Nebenwirkungen konsumiert werden.

Laktasen werden entweder als Prozesshilfe bei der Herstellung laktosefreier Molkereiprodukte eingesetzt oder vom laktoseintoleranten Verbraucher vor dem Verzehr eines Molkereiproduktes in Tablettenform oder als Puder eingenommen. Neben der

Anwendung aus diätetischen Gründen wird Laktase auch zur Verbesserung von Milchprodukten eingesetzt.

Je nach Anwendungsart gibt es Laktasen, die im neutralen pH-Bereich für reine Milchprodukte angewendet werden oder Laktasen mit einem sauren Aktivitätsbereich für die Herstellung von z. B. molkebasierten Produkten.

Alle industriellen Laktasen sind mikrobiellen Ursprungs. Die neutralen Laktasen werden aus Hefen wie zum Beispiel Kluyveromyces lactis (K. lactis) oder Kluyveromyces marxianus (K. marxianus) hergestellt, während die sauren Laktasen aus Aspergillus spec. gewonnen werden.

Einige der Laktaseprodukte aus Hefen haben eine Nebenaktivität, die dem laktasebehandelten Milchprodukt einen unangenehmen Geruch geben kann. Bei dieser Nebenaktivität handelt es sich um die Aktivität des Enzyms Arylsulfatase (EC 3.1 .6.1 ), das Cresolsulfat in Cresol und Sulfat spaltet. Cresol ist Ursache des unangenehmen Geruches.

In der Schrift EP 1 954 808 B1 ist ein Laktaseprodukt offenbart, das eine geringe Menge an Arylsulfatase enthält.

Offenbarung der Erfindung

Die Aufgabe der vorliegenden Erfindung ist es, die o. g. Nachteile zumindest teilweise zu überwinden. Insbesondere ist die Aufgabe der vorliegenden Erfindung Laktaseprodukte zu schaffen, die angenehm in der Anwendung sind und vorzugsweise neutral im Geruch sind.

Die voranstehende Aufgabe wird gelöst durch ein Enzymprodukt mit den Merkmalen des Anspruchs 1 sowie ein Enzymprodukt erhältlich durch eine neutrale beta-Galaktosidase mit den Merkmalen des Anspruchs 6. Zusätzlich wird die Aufgabe durch das Herstellungsverfahren nach Anspruch 8 und die Verwendung eines Produkts einer neutralen beta-Galaktosidase aus K. lactis nach Anspruch 9 gelöst.

Weitere Merkmale und Details der Erfindung ergeben sich aus den Unteransprüchen, der Beschreibung, den Zeichnungen sowie den genannten Beispielen. Dabei gelten Merkmale und Details, die im Zusammenhang mit dem erfindungsgemäßen Enzymprodukt beschrieben worden sind, selbstverständlich auch im Zusammenhang mit dem erfindungsgemäßen Enzymprodukt erhältlich durch eine neutrale beta-Galaktosidase sowie der erfindungsgemäßen Verwendung und dem erfindungsgemäßen Verfahren und jeweils umgekehrt, sodass bezüglich der Offenbarung zu den einzelnen Erfindungsaspekten stets wechselseitig Bezug genommen wird bzw. werden kann.

Ein erfindungsgemäßes Enzymprodukte zur Herstellung eines beta-Galaktosidaseproduktes zeichnet sich dadurch aus, dass das beta-Galaktosidaseprodukt eine inaktivierte Arylsulfatase enthält. Arylsulfatase ist ein Enzym, welches natürlicherweise in Hefen vorkommt und ist als beta-Galaktosidasepräparat-Nebenprodukt enthalten. Durch die Freisetzung von p-Cresol in Milch wird ein unangenehmer Geruch und Geschmack erzeugt. Die Inaktivierung kann vorliegend insbesondere genetisch erfolgen. Bei der genetischen Inaktivierung werden spezielle Gene reguliert, insbesondere herunterreguliert, sodass eine Inaktivierung der Genexpression stattfindet. Insbesondere durch eine Manipulation des Starts der Transkription oder der Translation kann die Expression eines Gens beeinflusst bzw. insbesondere inaktiviert werden. Der Start der Transkription, insbesondere an Promotoren, kann durch die genetische Regulation der spezifischen DNA-Sequenz verändert werden und somit kann die Expression des gesamten Gens aktiviert, gehemmt bzw. inaktiviert werden. Vorteilhafterweise wird bei einer inaktivierten Arylsulfatase gar keine Arylsulfatase produziert, insbesondere erst gar kein Arylsulfatase-Gen exprimiert, sodass ein störender Geruch und/oder Geschmack nicht lediglich reduziert wird, sondern erst gar nicht vorhanden ist.

Ferner ist es im Rahmen der vorliegenden Erfindung denkbar, dass das erfindungsgemäße Enzymprodukt ein beta-Galaktosidaseprodukt umfasst, wobei eine Laktase aus K. lactis enthalten ist. Nicht jedes Enzymprodukt aus Hefen der Gattung Kluyveromyces enthält Arylsulfatase. Durch klassische Stammentwicklung oder die Auswahl eines geeigneten Produktionsstammes ist es möglich ein arylsulfatasefreies beta-Galaktosidaseprodukt herzustellen. Durch Verbindung klassischer genetischer Modifikationen oder aber wie in dem hier vorliegenden Beispiel durch„Genom-Editierung" kann die Produktion der Arylsulfatase

durch gezieltes Ausschalten des Arylsulfatase-Gens unterbunden werden, um die Herstellung eines arylsulfatasefreien beta-Galaktosidaseproduktes zu ermöglichen. Mit einem arylsulfatasefreien beta-Galaktosidaseprodukt kann damit in der Milch keinerlei unangenehmer Geruch und/oder Geschmack resultierend aus der Aktivität des Enzyms Arylsulfatase produziert werden. Weiterhin ist es denkbar, dass die Erfindung auf einen K. lactis Stamm zur Herstellung eines erfindungsgemäßen Enzym Produktes gerichtet ist, wobei der K. lactis Stamm eine inaktivierte, insbesondere genetisch inaktivierte, Arylsulfatase aufweist. Vorteilhafterweise kann das erfindungsgemäße Verfahren in K. lactis durchgeführt werden.

Weiterhin ist es im Rahmen der vorliegenden Erfindung möglich, dass das Gen für die Arylsulfatase mittels Genom-Editierungs-Verfahren durch die Verwendung von künstlichen Nukleasen (Zink-Finger-Nuklease, ZFN; Transcription Activator-Like Effector Nuclease, TALEN) oder von programmierbaren Nukleasen der CRISPR-Technologie, insbesondere CRISPR-Cas9, inaktiviert ist. Die CRISPR-Technologie basiert auf die Komponenten von weitverbreiteten prokaryotischen Immunsystemen, die unter dem Akronym CRISPR (clustered regularly interspaced short palindromic repeats) zusammengefasst sind. Als CRISPR-Kassetten werden die Regionen in den prokaryotischen Genomen bezeichnet, die aus einer Anhäufung von kurzen, häufig palindromischen, DNA-Sequenzwiederholungen bestehen. In unmittelbarer Umgebung der CRISPR-Kassetten sind die cas- (CRISPR-assoziierte) Gene lokalisiert, die für Cas-Proteine mit Nukleinsäure-bindende, Helikase und/oder Nuklease-Aktivitäten kodieren. Für die Genom-Editierung werden die Komponenten der prokaryotischen CRISPR-Systeme, insbesondere Klasse II Systeme, verwendet. Hierzu gehören Cas-Proteine mit Nuklease-Aktivität, insbesondere Cas9, Cpf1 oder anderer Klasse II CRISPR-Nukleasen, deren Doppelstrang-DNA-Sequenzspezifitäten sich mit kurzen CRISPR-RNAs (crRNAs) bzw. synthetischen single-guide RNAs (sgRNAs) modulieren lassen. Durch den Einsatz der CRISPR-Technologie kann das Arylsulfatase-Gen inaktiviert werden. Damit ist dieses Gen nicht mehr vollständig/sinnhaft ablesbar, die Arylsulfatase wird nicht funktionell gebildet und ein entsprechender Geruch/Geschmack kann bei mit beta-Galaktosidase behandelten Milchprodukten nicht mehr erzeugt werden.

Weiterhin ist es denkbar im Rahmen der vorliegenden Erfindung, dass das beta-Galaktosidaseprodukt eine Laktase aus K. lactis 21 B7, K. lactis 21 B7AAS#1 und/oder K. lactis 21 B7AAS#9 enthält (CBS-Hinterlegungsnummern: CBS 142344 für K. lactis 21 B7, CBS 142345 für K. lactis 21 B7AAS#1 und CBS 142346 für K. lactis 21 B7AAS#9). Für K. lactis 21 B7 ist der Stamm K. lactis Y1 1 18 (CBS 6315) der Vorläuferstamm. Für K. lactis 21 B7AAS#1 und K. lactis 21 B7AAS#9 ist K. lactis 21 B7 der Vorläuferstamm. Beide Stämme K. lactis 21 B7AAS#1 und K. lactis 21 B7AAS#9 sind vorzugsweise durch das CRISPR/Cas-Verfahren hergestellt worden. Alle Stämme sind in der CBS Stammsammlung hinterlegt und enthalten keine fremde DNA oder eine neue Kombination an genetischem Material. Die Stämme umfassen lediglich die Deletion eines einzelnen Basenpaares (K. lactis 21 B7AAS#9) bzw. die Deletion von 289 Basenpaaren (K. lactis 21 B7AAS#1 ) im Arylsulfatase-Gen.

Gemäß einem weiteren Aspekt der Erfindung ist das Enzymprodukt durch eine neutrale beta-Galaktosidase aus K. lactis zur Herstellung eines arylsulfatasefreien beta-Galaktosidaseproduktes erhältlich. Dabei bringt die erfindungsgemäße Verwendung die gleichen Vorteile mit sich, wie sie ausführlich in Bezug auf eine erfindungsgemäße Zusammensetzung beschrieben worden sind. Die Inaktivierung kann wie hier vorliegend insbesondere auf genetischen Ebene erfolgen. Es können spezifische Gene reguliert werden, insbesondere herunterreguliert. Oder in einer anderen Ausführungsform wird das Gen zwar noch exprimiert, jedoch wird das Genprodukt in einer inaktiven Form gebildet. In beiden Fällen wird verhindert, dass sich ein störender Geruch und/oder Geschmack bilden kann.

Gemäß eines weiteren Aspektes der Erfindung ist das beta-Galaktosidaseprodukt ein Produkt zur Behandlung von Milcherzeugnissen. Folglich umfasst die vorliegende Erfindung auch Lebensmittel, insbesondere Milcherzeugnisse mit dem erfindungsgemäßen Enzymprodukt. Vorteilhafterweise kann es sich dabei um Milch, insbesondere um Kuhmilch oder aber auch um Milch anderer Nutztiere wie Schafe oder Ziegen handeln. Weiterhin kann das beta-Galaktosidaseprodukt zur Behandlung eines der folgenden Milcherzeugnisse verwendet werden: Frischmilch, H-Milch, Buttermilch, Creme fraiche, Dickmilch, Kondensmilch, Joghurt, Joghurterzeugnis, Sahne, Sahneerzeugnis, Schmand, Milchmischerzeugnis, Sahneerzeugnis, Butter, Milchpulver, Käse, Käseerzeugnis, Quark, Dulce de Leche. Des Weiteren ist die Erfindung auf Kosmetikprodukte sowie Reinigungs- und/oder Pflegeprodukte mit dem erfindungsgemäßen Enzymprodukt gerichtet, welche die beschriebenen Vorteile aufweisen.

Weiterhin ist es von Vorteil wenn das erfindungsgemäße Enzymprodukt das arylsulfatasefreie beta-Galaktosidaseprodukt aus Produktionsstämmen hergestellt ist, die durch die Anwendung von künstlichen oder programmierbaren Nukleasen, insbesondere der CRISPR-Technologie optimiert sind. Vorteilhafterweise kann mittels der CRISPR-Technologie das Arylsulfatase-Gen und damit auch die Funktion des Genproduktes, inaktiviert werden. Damit ist dieses Gen nicht mehr funktionell und ein entsprechender Geruch und/oder Geschmack kann bei der Produktion von Laktaseprodukten nicht mehr gebildet werden.

Das erfindungsgemäße Enzymprodukt ist insbesondere durch eine neutrale Laktase aus Kluyveromyces lactis, zur Herstellung eines beta-Galaktosidaseproduktes erhältlich. Dabei ist das beta-Galaktosidaseprodukt im Wesentlichen frei von Arylsulfatase-Aktivität. Unter im Wesentlichen frei kann verstanden werden, dass das beta-Galaktosidaseprodukt lediglich eine geringfügige bis keine Arylsulfatase-Aktivität aufweist, so dass die beschriebenen Vorteile im Rahmen des Enzymproduktes umfassend ein beta-Galaktosidaseprodukt erreicht werden.

Gemäß einem weiteren Aspekt der Erfindung wird das Produkt einer neutralen beta-Galaktosidase aus K. lactis zur Herstellung eines arylsulfatasefreien beta-Galaktosidaseproduktes verwendet. Dabei bringt die erfindungsgemäße Verwendung die gleichen Vorteile mit sich, wie sie ausführlich in Bezug auf eine erfindungsgemäße Zusammensetzung beschrieben worden sind.

Gemäß einem weiteren Aspekt der Erfindung ist ein Verfahren zur Herstellung eines beta-Galaktosidaseproduktes umfasst, wobei das beta-Galaktosidaseprodukt eine inaktive Arylsulfatase enthält.

Das Verfahren zur Herstellung eines beta-Galaktosidase-Produktes kann vorteilhafterweise zumindest einen der folgenden Schritte umfassen:

a) Bestimmung einer Zielsequenz des zu inaktivierenden Gens im Produktionsstamm, vorzugsweise K. lactis 21 B7,

b) Konstruktion eines Vektors, enthaltend Cas9 und eine sgRNA spezifisch für das Gen der Arylsulfatase des beta-Galaktosidase-produzierenden Stammes, vorzugsweise K. lactis 21 B7,

c) Transformation des beta-Galaktosidase-produzierenden Stammes, vorzugsweise K. lactis 21 B7,

d) Sequenzierung der Zielsequenz in den Transformanten zur Überprüfung der erfolgreichen Deletion oder Einführung von einzelnen Nukleotiden

e) Entfernung des Vektors aus b) durch Kultivierung erzeugter/bestätigter Knock-Out- Mutanten unter nicht-selektiven Bedingungen,

f) Permeabilisierung der Knock-Out-Mutanten durch chemische Behandlung, g) Trennung des Permeats von der Biomasse (insbesondere aus Schritt c)),

h) Bestimmung der Enzymaktivitäten von beta-Galaktosidase und Arylsulfatase im Permeat (Verhältnis Arylsulfatase Units/Neutrale Laktase Units, ASU/NLU).

Die einzelnen Schritte müssen dabei nicht notwendigerweise in der angegebenen Reihenfolge oder zeitlich hintereinander durchgeführt werden. Vielmehr können einzelne Schritte auch zeitlich parallel stattfinden, z. B können Schritt a) und b) simulatan durchgeführt werden. Zumindest die Schritte c), d) und e) laufen vorzugsweise nacheinander ab. Auch die Schritte f), g) und h) können nacheinander durchgeführt werden.

Molekularbiologische Verfahren

Die Escherichia coli Stämme (E. coli) DH5-alpha und DH10-beta dienen als Empfängerorganismen für die Konstruktion und Propagierung von CRISPR/Cas9 [pKmARS7]-Vektorderivaten. Die Kultivierung von erzeugten E. coli Stämmen erfolgt in Luria-Bertani Medium (LB-Medium), das 5 g/l Hefeextrakt, 10 g/l Trypton, 5 g/l Natriumchlorid enthält. Für die Verwendung als Festmedium, wird LB-Medium mit 1 ,5 % (w/v) Agar versetzt. Alle Medien werden vor dem Gebrauch hitzesterilisiert. Sofern selektive Kultivierungsbedingungen erforderlich sind, enthalten die Medien Ampicillin in einer finalen Konzentration von 100 μg/ml und Kanamycin in einer finalen Konzentration von 25 μg/ml.

Die Genese des beta-Galaktosidase Produzenten K. lactis 21 B7 wird in der Arbeit von Wellenbeck et al., Engineering in Life Sciences (2016), doi:10.1002/elsc.201600031 beschrieben. Der Stamm wird gewöhnlich in komplexem Yeast-Pepton-Dextrose Medium (YPD-Medium) kultiviert, das 10 g/l Hefeextrakt, 10 g/l Pepton und 20 g/l Glukose enthält. Für die Verwendung als Festmedium, wird YPD-Medium mit 2,0 % (w/v) Agar versetzt. Alle Medien werden vor dem Gebrauch hitzesterilisiert. Rekombinante K. lactis 21 B7 Zellen mit eingeführten [pKmARS7]-Vektorderivaten werden in YPD-Medium mit dem Antibiotikum Geneticin (G418) in einer finalen Konzentration von 25 μg ml kultiviert.

Kommerziell vorbereitete chemisch- und elektrokompetente E. coli DH5-alpha bzw. DH10-beta Zellen werden für Transformationszwecke bei New England Biolabs (NEB, Frankfurt) erworben und entsprechend den Herstellerangaben behandelt. Transformierte E. coli Zellen werden unter selektiven Bedingungen auf LB-Agarmedien identifiziert.

Konstruierte [pKmARS7]-Vektoren für die Targetierung der genomischen Arylsulfatase-Gensequenz werden durch Elektroporation in K. lactis 21 B7 Zellen eingeführt. Die Präparation der elektrokompetenten Zellen sowie die Durchführung der Transformation erfolgt entsprechend einem publizierten Vorgehen von Sänchez et al., Applied and Environmental Microbiology 59 (1993), 2087-92. 10 ml YPD-Medium werden mit einer Einzelkolonie beimpft und für die Dauer von 16 h bei 30 °C auf einem Horizontalschüttler mit einer Frequenz von 250 rpm inkubiert. Mit Zellen dieser Kultur werden nachfolgend 100 ml YPD-Medium auf eine optische Dichte bei 600nm (OD600) von 0,2 eingestellt. Die beimpfte Kultur wird bis zum Erreichen einer optischen Dichte OD600 von 0,8 bis 1 ,4 bei 30 °C auf einem Horizontalschüttler mit einer Frequenz von 250 rpm inkubiert. Nach der Ernte der Kultur durch Zentrifugation für die Dauer von 5 min bei 10 °C und 1900 x g, wird das erhaltene Zellpellet in 10 ml Vorbehandlungs-Puffer [YPD-Medium mit 20 mM 4-(2-Hydroxyethyl)-piperazin-1 -ethansulfonsäure,N-(2-Hydroxyethyl)-piperazin-N'-2-ethansulfonsäure (HEPES), pH 8,0; 25 mM 1 ,4-Dithioerythritol (DTT)] aufgenommen und für die Dauer von 30 min bei 30 °C auf einem Horizontalschüttler mit einer Frequenz von 100 rpm inkubiert. Die vorbehandelten Zellen werden durch Zentrifugation für die Dauer von 5 min bei 10 °C und 1900 x g aus der Suspension abgetrennt und das erhaltene Zellpellet in 10 ml Elektroporations-Puffer [10 mM Tris-HCI, pH 7,5; 270 mM Saccharose; 1 mM Lithiumacetat] resuspendiert. Nach einem weiteren Zentrifugationsschritt für die Dauer von 5 min bei 10 °C und 1900 x g werden die pelletierten Zellen schließlich in 300 μΙ Elektroporations-Puffer aufgenommen. Zellaliquots von 50 μΙ werden bis zum Gebrauch bei -80 °C gelagert. Für die Transformation werden 50 μΙ Zellen mit 300 ng Plasmid-DNA in einer Elektroporationsküvette mit 2 mm Spaltbreite gemischt und 15 min auf Eis gelagert. Die Elektroporation erfolgt in einem BioRad Gene Pulser Xcell Elektroporations-System (BioRad, München) bei 1 ,0 kV, 400 Ω und 25 mF. Unmittelbar nach dem Puls, werden die Zellen in der Küvette zunächst in 1 ml eiskaltem YPD-Medium verdünnt, anschließend in ein konisches 15 ml Röhrchen überführt und nachfolgend 4 h bei 30 °C auf einem Horizontalschüttler mit einer Frequenz von 250 rpm kultiviert. Transformierte K. lactis 21 B7 Zellen mit eingeführten [pKmARS7]-Vektorderivaten werden auf Geneticin-haltigem YPD-Agarmedium für 2 bis 5 Tage bei 30 °C selektioniert.

Die verwendeten Verfahren für die Isolierung von Plasmid-DNA, die enzymatische Modifikation von Nukleinsäuren, die Ligation von Nukleinsäuren, die enzymatische Amplifikation von Nukleinsäuren durch Polymerase-Kettenreaktion (PCR) und die elektrophoretische Trennung und Reinigung von Nukleinsäuren in Agarosegelen entsprechen dem Stand der Technik. Soweit nicht anders vermerkt, werden die Methoden in Anlehnung an die im dem Standardwerk von Sambrook et al. Molecular Cloning, A Laboratory Manual, 2. Auflage 1989, CHS Press, Cold Spring Habor, beschriebenen Protokolle durchgeführt.

Für die Isolierung von Plasmid-DNA aus rekombinanten E. coli Zellen wird das GeneJET Plasmid Miniprep Kit (Thermo Fisher Scientific, Darmstadt) nach Herstellerangaben verwendet. Die Amplifikation von Nukleinsäuren durch PCR erfolgt vorzugsweise mit dem Phusion Flash High-Fidelity PCR System (Thermo Fisher Scientific, Darmstadt). Alle eingesetzten Oligonukleotide wurden durch den Dienstleister biomers.net (biomers.net, Ulm) synthetisiert. Sofern erforderlich, werden Nukleinsäuren aus enzymatisch katalysierten Reaktionen sowie aus Agarosegelen mit dem Qiagen MinElute System (Qiagen, Hilden) oder dem ZymoCIean Gel DNA Recovery System (Zymo Research, Freiburg) nach Herstellerprotollen gereinigt. Die Identität erzeugter PCR-Amplikons und klonierter Nukleinsäuren wird durch Sanger-Sequenzierung beim Dienstleister GATC Biotech (GATC Biotech, Konstanz) beauftragt.

Die Isolierung genomischer DNA aus dem Stamm K. lactis 21 B7 erfolgt aus 2 OD Zellen (OD600) einer Übernachtkultur mit dem Zymo Research YeaStar Genomic DNA System (Zymo Research, Freiburg). Die Degradation der Zellwand mit dem Enzym Zymolyase wird für 1 h bei 37 °C durchgeführt und die gereinigte genomische DNA in 60 μΙ Qiagen EB-Puffer (Qiagen, Hilden) eluiert.

Analyse der Zielsequenz in K. lactis 21 B7

Die unter der Zugangsnummer NC_006042 in der NCBI-Datenbank (www.ncbi.nlm.nih.gov/nucleotide/) verfügbare Genomsequenz des Stammes K. lactis NRRL Y-1 140 dient als Referenz für die Amplifikation und Sequenzanalyse des Arylsulfatasegens in K. lactis 21 B7. Im Genom des Stammes K. lactis NRRL Y-1 140 codiert der annotierte offene Leserahmen mit der Bezeichnung KLLA0_F03146g und einer Größe von 1668 bp für ein konserviertes hypothetisches Protein mit 555 Aminosäuren. Die Kyoto Encyclopedia of Genes and Genomes Datenbank (KEGG, http://www.genome.jp) weist dem Protein aufgrund der Sequenzhomologie die Funktion einer Arylsulfatase zu (KLLA0F03146g). Der experimentelle Nachweis für die Arylsulfatase-Aktivität des Proteins kann in der Arbeit von Stressler et al., Applied Microbiology and Biotechnology, 100 (2016), 5401 -5414, gezeigt werden. Die abgeleiteten Primer ATM358 (5'-TTCGCTCCACCCGATCATGAGAGTTTACAG-3') und ATM359 (5'-TGTAATGGCCAATGTGGAGCTGTGTAGGTC-3') erzeugen in einer PCR-Reaktion mit genomischer DNA aus K. lactis 21 B7 ein spezifisches Amplikon mit einer Größe von 894 bp (PCR-Bedingungen: 30 ng genomische DNA, 12,5 pmol Primer; 25 μΙ Reaktionsvolumen; Initiale Denaturierung, 98 °C, 10 sec; PCR-Zyklus: 35 x [98 °C, 5 sec; 60 °C 5 sec; 72 °C, 14 sec], 72 °C, 60 sec). Das erzeugte Amplikon setzt sich aus 238 bp der 5'-UTR und 656 bp der codierenden Arylsulfatase-Gensequenz zusammen. Für die Bestimmung der Nukleotidsequenz werden die Blunt-End PCR-Produkte in das Thermo Fisher Scientific pCR-Blunt-Vektorsystem (Thermo Fisher Scientific, Darmstadt) entsprechend dem Herstellerprotokoll kloniert und die Ligationsprodukte in kompetente E. coli Zellen transformiert. Plasmid-DNA wird aus rekombinanten E. coli Zellen isoliert und die Sequenz der inserierten Amplikons durch Sanger-Sequenzierung mit den zur Klonierungsstelle flankierenden Primern M13f (5 -TGTAAAACGACGGCCAGT-3') und M13r (5'-CAGGAAACAGCTATGACC-3') bestimmt. Die ermittelte Nukleotidsequenz für das 894 bp große Amplikon ist in der Sequenz 1 dargestellt. Im Vergleich zur Referenzsequenz aus K. lactis NRRL Y-1 140 kann für den entsprechenden Genomabschnitt in K. lactis 21 B7 ein

Basenunterschied in der codierenden Arylsulfatase-Gensequenz festgestellt werden. Die Veränderung des Tripletts von CGT zu AGT in der Nukleinsäuresequenz (Sequenz 1 ) führt dabei zu dem Austausch der Aminosäure Arginin gegen Serin in der Primärsequenz in der Position 139 des Proteins (Sequenz 2). Nach der Publikation von Stressler et al., Applied Microbiology and Biotechnology, 100 (2016), 9053-9067, stellt das Protein mit der Aminosäure Serin in der Position 139 die aktive Arylsulfatase-Variante dar. Die ermittelte Sequenzinformation dient als Referenz für die Inaktivierung des Arylsulfatase-Gens in K. lactis 21 B7 durch CRISPR/Cas9.

Die Sequenz 1 umfasst dabei ein 894 bp Amplikon (Primerpaar ATM358/ATM359) mit der Arylsulfatase-Teilsequenz aus K. lactis 21 B7 (in Klammern: offener Leserahmen, ORF):

TTCGCTCCACCCGATCATGAGAGTTTACAGAAAGTTCTTACCTTGAAACTTTTTTACTGC

ACCCTTTTTATCACTTCGAGTAAAGCTTTAAATGACATAATTTACAATATAAATATGGATC

ATCTCACCTGTCATCATGGTCTTTTAGGAATTGTGAAGGTATACTAACCAATTGTTACTC

TATGATCTATCCGAAAATCCGCAAACTGCATTAGAGAAAAGTACAATCGAATTGCA[ATG

ACCAAAACAGATGAACCTAAAAAGCCGAATTTCTTAATTATTGTCGCCGATGATTTAGGG

TTTACAGATGTGTCGAGTTTTGGAGGTGAAATACAAACGCCAAACCTTGATAAATTGTCT

AAAGGTGGTTTCAGATTCACTGGTTTTCATACTGCATCGGCATGTTCGCCAACTAGATC

GATGTTGTTGAGCGGTACTGACAACCATTTGGCAGGTTTGGGCCAAATGGCTGAATATG

CCAGG CAATTTC CAG AAAAGTTCAAG G ATAAACCTG GTTATG AAG GTTATTTG AACTATA

AGGTTGCTGCATTGCCTGAAATATTATCCCCAGAATATTACACGCTGATTTCGGGGAAAT

GGCACCTTGGATTAGAAAAGCCATATTGGCCAAGTGACCGTGGATTCCAAAAAAGTTTT

ACCTTGCTGCCTGGTGCAGGAAACCATTTCAAATGCAATTTGGATAGCAAGTTTCTTCTC

CCATGGATTTATCAGGAAAATGGCGAAAGGGTAGACCATAACAAGTTTCCAGAAAACTT

TTATTCCACCACTTACTTCACAGATAAATTTTTGGAATATTTGAAGGATGATGAAGAAAGA

AAAGGTCGCCCATTCTTTGGCCAGTTGACCTACACAGCTCCACATTGGCCATTACA].

Die Sequenz 2 umfasst dabei eine translatierte Protein-Teilsequenz der Arylsulfatase aus K. lactis 21 B7:

MTKTDEPKKPNFLIIVADDLGFTDVSSFGGEIQTPNLDKLSKGGFRFTGFHTASACSPTRSLL SGTDNHLAGLGQMAEYARQFPEKFKDKPGYEGYLNYKVAALPEILSPEYYTLISGKWHLGL

EKPYWPSDRGFQK[S]FTLLPGAGNHFKCNLDSKFLLPWIYQENGERVDHNKFPENFYSTT YFTDKFLEYLKDDEERKGRPFFGQLTYTAPHWPL.

Konstruktion des [pKmARS7]-Basis-Vektors

Der eingesetzte Basis-Vektor mit einer Größe von 3924 bp enthält zumindest eines der folgenden Elemente: ARS7-Replikon, TEF1 p-Promotor, EM7p-Promotor, CYC1t-Transkriptionsterminator, kanMX-Resistenzgen, ColE1 -Replikon, CPS1t- Transkriptionsterminator. Das Element ARS7 ist eine autonom replizierende DNA-Sequenz ARS7 aus K. marxianus DSM70344 (Autonomously Replicating Sequence, KmARS7) für die episomale Propagierung des Vektors in K. lactis 21 B7. Das Element TEF1 p-Promotor ist ein Promotor des Transcription Elongation Factor 1 Gens aus Saccharomyces cerevisiae (S. cerevisiae) für die Expression des Kanamycin-Resistenzgens in K. lactis 21 B7. Das Element EM7p-Promotor ist ein synthetischer prokaryotischer Promotor für die Expression des Kanamycin-Resistenzgens in E. coli. Das Element CYC1t Transkriptionsterminator ist ein 3'-Bereich zum CYC1 -Gen aus S. cerevisiae für die Termination der Transkription des kanMX-Resistenzgens. Das Element kanMX-Resistenzgen ist ein Kanamycin-Resistenzgen. Das Element ColE1 -Replikon dient der episomalen Replikation des Vektors in E. coli. Das Element CPS1t Transkriptionsterminator ist ein 3'-Bereich zum CPS1 -Gen aus S. cerevisiae für die Termination von inserierten Genen in der flankierenden Klonierungsstelle.

Genom-Editierung

Die Anwendung der CRISPR/Cas9-Technologie für die Genom-Editierung ausgewählter Gene in K. lactis ist in der Arbeit von Horwitz et al., Cell Systems 1 (2015), 88-96, beispielhaft gezeigt. Die Expression der human Codon-optimierten Cas9-Nuklease und die Transkription basenspezifischer single-guide RNA (sgRNA) ermöglicht die präzise Einführung von DNA-Doppelstrangbrüchen in K. lactis ATCC 8585 und nachfolgend die Inaktivierung oder Veränderung von Zielgenen über den zelleigenen Reparaturmechanismus über "non-homologous end joining" (NHEJ). Für die Einführung von Knock-Out-Mutationen in das genomisch codierte Arylsulfatasegen in K. lactis 21 B7, wurde ausgehend von dem vorliegenden E. coli/K. marxianus Shuttle-Vektor [pKmARS7]-MCS2-CPS1 T-kanMX ein CRISPR/Cas9-System etabliert.

In den Basisvektor [pKmARS7] (s.o.) mit der hCas9-Expressionskassette ([pKmARS7]-TPI1 p-hCas9-CPS1 t-kanMX) wurde eine SNR52-Transkriptionskassette für die Erzeugung der Chimären sgRNA bestehend aus der crRNA- und tracrRNA-Sequenzen eingesetzt. Die prinzipielle Struktur der sgRNA entspricht der in der Arbeit von Jinek et al., Science 337 (2012), 816-821 , publizierten Konstruktion. Das 426 bp umfassende DNA-Fragment enthält stromabwärts zum SNR52 RNA Polymerase Ill-Promotor (DiCarlo et al., Nucleic Acids Res 41 (2013), 4336-4343), eine BsmBI-Klonierungsstelle für die Modulation der ersten 20 Nukleotide (targetspezifische guide-Sequenz) der sgRNA durch die Golden Gate Assemblierung (Engler and Marillonnet, Methods Mol Biol (2014), 1 19-131 ). Für Klonierungszwecke flankieren die Erkennungssequenzen der Restriktionsendonukleasen Agel und Sbfl die SNR52-sgRNA-Transkriptionseinheit. Nach der Agel/Sbfl Hydrolyse wurde die 423 bp umfassende Kassette in das 8703 bp große Xmal/Sbfl [pKmARS7]-TPI 1 p-hCas9-CPS1 t-kanMX Vektorfragment inseriert. Nachfolgend wurden im erzeugten Vektor die Erkennungssequenzen der Restriktionsendonuklease BsmBI in den codierenden hCas9- und kanMX-Gensequenzen durch Einführung synonymer Tripletts entfernt. Die Modifikation dieser Sequenzen ermöglicht die direkte Einführung zielspezifischer guide-Sequenzen in den mit BsmBI hydrolysierten Vektor [pKmARS7]-TPI 1 p-hCas9-SNR52p-sgRNA.

Weitere, die Erfindung verbessernde Maßnahmen ergeben sich aus der nachfolgenden Beschreibung zu einigen Ausführungsbeispielen der Erfindung. Sämtliche aus den Ansprüchen oder der Beschreibung hervorgehende Merkmale und/oder Vorteile, einschließlich aller Einzelheiten, möglichen Verwendungen und Verfahrensschritte, können sowohl für sich als auch in den verschiedensten Kombinationen erfindungswesentlich sein. Dabei ist zu beachten, dass die Beispiele nur beschreibenden Charakter haben und nicht dazu gedacht sind, die Erfindung in irgendeiner Form einzuschränken.

Beispiel 1 : Inaktivierung der Arylsulfatase in K. lactis 21 B7 durch CRISPR/Cas9

Die Nukleotidsequenz der Arylsulfatase im Genom des Stammes K. lactis 21 B7 (siehe Sequenz 1 ) dient als Referenz für die Identifizierung potentieller Cas9-Zielsequenzen in der codierenden Gensequenz des Enzyms. Als geeignete Zielsequenz für die Aktivität der SpCas9-Nuklease gilt die Basenabfolge "N(20)NGG" (Deltcheva et al., Nature 471 (201 1 ), 602-607). Das kanonische "NGG" Sequenzmotiv wird als "Protospacer adjacent motif

(PAM)" bezeichnet und folgt unmittelbar der 20 Basen umfassenden Targetsequenz (Protospacer). Die Aktivität des Cas9-sgRNA Komplexes führt zu einem DNA-Doppelstrang-Bruch an einer definierten Position, die drei Basenpaare stromaufwärts des PAMs innerhalb des Protospacers lokalisiert ist.

Für die genetische Inaktivierung der Arylsulfatase in K. lactis 21 B7 werden beispielhaft die folgenden drei CRISPR/Cas9 Zielsequenzen mit der Basenabfolge "N(20)NGG" in der zugehörigen codierenden Gensequenz identifiziert. Die PAM-Motive sind in den Sequenzen fett dargestellt.

Protospacer-PAM Targetsequenz Nr. 1 :

Basen 266 bis 288 in der Sequenz 1 , nicht-codogener DNA-Strang,

5'-GCGACAATAATTAAGAAATTCGG-3'

Protospacer-PAM Targetsequenz Nr. 2:

Basen 344 bis 366 in der Sequenz 1 , codogener DNA-Strang

5'-AACCTTGATAAATTGTCTAAAGG-3'

Protospacer-PAM Targetsequenz Nr. 3:

Basen 430 bis 452 in der Referenzsequenz Nr. 1 , codogener DNA-Strang,

5'-GAGCGGTACTGACAACCATTTGG-3'

Das molekularbiologische Vorgehen zur genetischen Inaktivierung der Arylsulfatase im Genom des Stammes K. lactis 21 B7 wird nachfolgend am Beispiel der identifizierten Protospacer-PAM Targetsequenz Nr. 1 dargestellt: Die zueinander komplementären Oligonukleotide ATM381_Sp1AS_f (5'-GATCGCGACAATAATTAAGAAATT-3') und ATM382_Sp1AS_r (5'-AAACAATTTCTTAATTATTGTCGC-3') werden in den BsmBI-hydrolysierten CRISPR/Cas9-Vektor [pKmARS7]-TPI 1 p-hCas9-SNR52p-sgRNA durch Golden Gate Assemblierung eingefügt und die Ligationsprodukte in kompetente E. coli Zellen transformiert. Die Identität der inserierten Oligonukleotide wurde in isolierter Plasmid-DNA durch Sanger-Sequenzierung bestätigt. Das erzeugte Konstrukt [pKmARS7]-TPI1 p-hCas9-SNR52p-Sp1ASsgRNA wird durch Elektroporation in kompetente K. lactis 21 B7 Zellen eingeführt und Transformanten auf YPD-Agarmedium mit Geneticin (G418)

selektioniert. Die genomische DNA ausgewählter rekombinanter Klone dient als PCR-Template für den Nachweis potentieller Indel-Mutationen (Insertion/Deletion) in der auswählten CRISPR/Cas9 Zielsequenz. Hierfür wird mit den Primern ATM358 (5 -TTCGCTCCACCCGATCATGAGAGTTTACAG-3') und ATM359 (5'- TGTAATGGCCAATGTGGAGCTGTGTAGGTC-3') ein spezifisches PCR-Produkt erzeugt und die Nukleotidsequenz des Amplikons im Bereich der CRISPR/Cas9 Targetierungsstelle mit dem Primer ATM397 (5'-TGGAATCCACGGTCACTTGG-3') durch Sanger-Sequenzierung bestimmt. Die Sequenzanalyse führt für die Mehrzahl der untersuchten Klone zum Nachweis einer Basenpaardeletion im Bereich der ausgewählten Protospacersequenz. Der erzeugte Frameshift in der Position 33 der codierenden Arylsulfatase-Gensequenz bewirkt die vorzeitige Termination des Leserahmens. Die genetische Inaktivierung des Zielgens durch CRISPR/Cas9 ist beispielhaft in der Sequenz 3 für den untersuchten Klon#9 K. lactis 21 B7 Sp1AS#9 dargestellt. In der Sequenz 4 sind der resultierende ORF und die zugehörige Proteinsequenz der Arylsulfatase dargestellt.

Die Sequenz 3 umfasst eine Deletionsmutante K. lactis 21 B7 Sp1AS#9 (Teilsequenz des codierenden Arylsulfatasegens). Das deletierte Nukleotid ist in Klammern dargestellt:

ATGACCAAAACAGATGAACCTAAAAAGCCGAA[T]TTCTTAATTATTGTCGCCGATGATTT

GGGTTTACAGATGTGTCGAGTTTTGGAGGTGAAATACAAACGCCAAACCTTGATAAATT

GTCTAAAG GTG GTTTC AG ATTCACTG GTTTTCATACTG CATC GG CATGTTCG CCAACTA

GATCGATGTTGTTGAGCGGTACTGACAACCATTTGGCAGGTTTGGGCCAAATGGCTGAA

TATGCCAGGCAATTTCCAGAAAAGTTCAAGGATAAACCTGGTTATGAAGGTTATTTGAAC

TATAAGGTTGCTGCATTGCCTGAAATATTATCCCCAGAATATTACACGCTGATTTCGGGG

AAATGGCACCTTGGATTAGAAAAGCCATATTGGCCAAGTGACCGTGGATTCCA.

Die Sequenz 4 umfasst einen resultierenden ORF mit 39 bp und die zugehörige Proteinsequenz der Arylsulfatase im Klon K. lactis 21 B7 Sp1AS#9: ATG ACC AAA ACA GAT GAA CCT AAA AAG CCG AAT TCT TAA (translatierte Proteinsequenz: MTKTDEPKKPNS).

Im dem analysierten Klon#1 K. lactis 21 B7 Sp1AS#1 kann als Folge der Cas9-sgRNA-Aktivität mit dem Protospacer Nr. 1 die Deletion von 289 bp im Arylsulfatasegen festgestellt werden. Der deletierte Bereich ist in der Sequenz 5 dargestellt. In der Sequenz 6 ist der resultierende ORF und die zugehörige Proteinsequenz der Arylsulfatase für die Deletionsmutante K. lactis 21 B7 Sp1AS#1 wiedergegeben.

Die Sequenz 5 umfasst eine Deletionsmutante K. lactis 21 B7 Sp1AS#1 (N-terminale Teilsequenz des codierenden Arylsulfatasegens, der Bereich in Klammern entspricht dem Deletionsbereich des Stammes CBS 142345):

ATGACCAAAACAGATGAACCTAAAAAGCCGAAT[TTCTTAATTATTGTCGCCGATGATTTA

GGGTTTACAGATGTGTCGAGTTTTGGAGGTGAAATACAAACGCCAAACCTTGATAAATG

TCTAAAGGTGGTTTCAGATTCACTGGTTTTCATACTGCATCGGCATGTTCGCCAACTAGA

TCGATGTTGTTGAGCGGTACTGACAACCATTTGGCAGGTTTGGGCCAAATGGCTGAATA

TG CCAG G CAATTTCCAG AAAAGTTCAAGG ATAAAC CTGGTTATGAAG GTTATTTG AACTA

TAAGGTTGCTGCATTGCCTGAAA]TATTATCCCCAGAATATTACACGCTGATTTCGGGGA

AATGGCACCTTGGATTAGAAAAGCCATATTGGCCAAGTGACCGTGGATTCCA.

Die Sequenz 6 umfasst einen resultierenden ORF mit 60 Nukleotiden und zugehörige Proteinsequenz der Arylsulfatase im Klon K. lactis 21 B7 Sp1 AS#1 : ATG AC C AAAAC AG ATG AAC CTAAAAAG C C G AATTATTATC C C C AG AATATTAC ACGCTGA, translatierte Proteinsequenz: MTKTDEPKKPNYYPQNITR.

Die verwendeten CRISPR/Cas9 [pKmARS7]-Vektorderivate werden aus den charakterisierten K. lactis 21 B7 Arylsulfatase Knock-Out-Mutanten durch mehrmalige Kultivierungspassagen in YPD-Medium ohne Antibiotika-Zusatz entfernt.

Beispiel 2: Expression von Laktase und Arylsulfatase in K. lactis 21 B7 und Erzeugung von K. lactis Biomasse

Biomasse des K. lactis Stamms 21 B7 (CBS 142344) und der Deletionsmutanten CBS 142345 und CBS 142346 mit intrazellulärer Laktase wird durch Fermentation vermehrt. Dies kann durch Kultivierung über 72 h in einem für Hefen geeigneten Mineralsalzmedium und Zuführung eines Substratfeeds unter Anwendung von Fermentationsmethoden nach aktuellem Stand der Technik realisiert werden. Beispiele hierfür sind in einer Vielzahl von Veröffentlichungen dokumentiert (Wellenbeck et al., Engineering in Life Sciences (2016);

Inchaurrondo et al., Process Biochemistry (1994); Fonseca et al., Applied Microbiology and Biotechnology (2013)).

Die erzeugte Biomasse enthält das intrazelluläre Zielenzym Laktase. Um dieses anzureichern wird die Biomasse zuerst aufgeschlossen. Dazu wird die von Fenton et al. (1980) beschriebene Zellaufschlussmethoden verwendet, bei der die Laktase durch den Kontakt der Zellen mit einem Alkylalkohol oder einem Dialkylalkohol in die wässrige Phase freigesetzt wird. Anschließend werden die Zellen durch Filtration abgetrennt und das Enzym durch Ultrafiltration bei einem Cut-off von 50 kDa auf eine Aktivität von etwa 7500 NLU (Neutrale Laktase Units)/g konzentriert und per Diafiltration mit einem Phosphatpuffer gereinigt. Anschließend wird das Laktase-Präparat durch die Zugabe von Glycerin entsprechend 25 % des Gesamtvolumens stabilisiert.

Die in den Präparaten enthaltene Laktase-Menge wird in Neutrale Laktase Units (NLU) der Enzymaktivität gemessen. Dabei entspricht eine NLU der Umsetzung von 1 ,3 μηηοΙ Substrat pro Minute unter den Bedingungen des Assays. In dem verwendeten Assay wird das synthetische Substrat o f/?o-Nitrophenol-beta-D-Galactopyranosid (ONPG) von der Laktase hydrolytisch gespalten und es entstehen die Produkte o f/?o-Nitrophenol (ONP) und Galaktose. Die Umsetzung erfolgt über einen Zeitraum von 15 min bei 30 °C in einem 100 mM Kaliumphosphatpuffer bei pH 6,5 mit 1 mM Magnesiumsulfat und 0,05 mM EDTA. Die umgesetzte Substratmenge kann über die Absorption des Produkts ONP bei 420 nm durch eine Kalibrierung mit unterschiedlich konzentrierten ONP-Lösungen berechnet werden.

Die in den Präparaten enthaltene Menge Arylsulfatase wird in Arylsulfatase Units (ASU) der Enzymaktivität gemessen. Die Aktivität wird mit dem Substrat Paranitrophenylsulfat entsprechend der Messmethode nach De Swaaf et al., European Patent Application, EP2439266A2 (2012) gemessen. Eine ASU ist definiert als die Veränderung der OD bei 410nm (OD410) *10E6 pro Stunde unter den Bedingungen des Assays.

Weitere, die Erfindung verbessernde Maßnahmen ergeben sich aus der dargestellten Figur. Sämtliche aus den Ansprüchen, der Beschreibung oder der Zeichnung hervorgehende Merkmale und/oder Vorteile, einschließlich konstruktiver Einzelheiten, räumliche Anordnungen und Verfahrensschritte, können sowohl für sich als auch in den

verschiedensten Kombinationen erfindungswesentlich sein. Dabei ist zu beachten, dass die Figur nur beschreibenden Charakter hat und nicht dazu gedacht ist, die Erfindung in irgendeiner Form einzuschränken. Es zeigt:

Figur 1 : Ergebnisse der Quantifizierung der Arylsulfataseaktivität in den Laktasepräparaten der untersuchten Stämme von K. lactis

In Figur 1 wird die Arylsulfataseaktivität in Abhängigkeit der Laktaseaktivität dargestellt (ASU pro NLU). Im Laktasepräparat, das aus der Fermentation mit dem Stamm K. lactis 21 B7 hergestellt wird, liegt die Arylsulfataseaktivität im Mittel bei 590 ASU pro NLU, bei einem kommerziell erhältlichen Referenzenzym bei 55 ASU/NLU. Bei den Deletionsmutanten K. lactis 21 B7 Sp1AS#1 bzw. K. lactis 21 B7 Sp1AS#9 liegt die Arylsulfataseaktivität im Mittel bei nur 0 bis 6 ASU pro NLU. Die Messwerte für die Mutanten liegen in der Nähe der Nachweisgrenze des verwendeten Assays. Die Inaktivierung des codierenden Arylsulfatasegens hat somit in beiden untersuchten Deletionsmutanten zur Folge, dass die Aktivität der Arylsulfatase im aufgereinigten Präparat der Laktase stark reduziert wird oder sich sogar unter der Nachweisgrenze des verwendeten Assays befindet.