بعض محتويات هذا التطبيق غير متوفرة في الوقت الحالي.
إذا استمرت هذه الحالة ، يرجى الاتصال بنا علىتعليق وإتصال
1. (WO2019066140) PHARMACEUTICAL COMPOSITION AND BIOMATERIAL COMPRISING FUSION PEPTIDE HAVING PARATHYROID HORMONE (PTH) CONJUGATED WITH PEPTIDE SELECTIVE FOR BONE TISSUE
Document

명세서

발명의 명칭

기술분야

1   2  

배경기술

3   4   5   6   7   8   9   10   11   12   13   14   15   16   17   18   19   20   21   22  

도면의 간단한 설명

23   24   25   26   27   28   29   30   31   32   33   34   35   36   37   38   39   40   41   42   43   44   45   46   47   48   49   50   51   52   53   54   55   56   57   58   59   60   61   62   63   64   65   66   67   68   69   70   71   72   73   74   75   76   77   78   79   80   81   82   83   84   85   86   87   88   89   90   91   92   93   94   95   96   97   98   99   100   101   102   103   104   105   106   107   108   109   110   111   112   113   114   115   116   117   118   119   120   121   122   123   124   125   126   127   128   129   130   131   132  

산업상 이용가능성

133   134   135   136   137  

청구범위

1   2   3   4   5   6   7   8   9   10   11   12   13   14   15   16   17   18   19   20   21   22  

도면

1   2   3   4   5  

명세서

발명의 명칭 : 부갑상선호르몬(parathyroid hormone, PTH)에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드를 포함하는 약학 조성물 및 생체재료

기술분야

[1]
본 발명은 부갑상선호르몬(parathyroid hormone, PTH) 또는 그 절편에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드를 포함하는 골 질환 예방 또는 치료용 약학 조성물 및 생체재료에 관한 것이다.
[2]

배경기술

[3]
부갑상선호르몬(parathyroid hormone, PTH)은 부갑상선에서 분비되는 84개의 아미노산으로 이루어진 펩타이드 호르몬이다. 주 작용부위는 부신피질로서, 부신피질 막에 결합하여 cAMP와 IP3(이노시톨 트리포스페이트), DAG(디아실 글리세롤)의 생산을 증가시키는 생리활성 물질이다. PTH는 칼슘의 골 흡수 및 신장 흡수를 증가시킴으로써 혈액의 칼슘 농도를 증가시킨다. 또한, 간헐적으로 투여하는 PTH는 조골세포를 자극하여 골형성을 유도한다.
[4]
에스트로젠, 칼시토닌, 비스포스포네이트 등의 골다공증 치료제는 골 흡수를 억제하는 기전을 가지고 있는 반면에 PTH는 골 형성을 촉진하는 기전을 가지고 있다. 골 흡수를 억제하는 약제들만으로는 이미 진행된 골다공증 환자의 골량을 증가시키기에 미흡하지만, PTH는 골 형성을 직접적으로 촉진하는 기전을 가지고 있기 때문에, 골 재형성이 감소된 제2형 골다공증 또는 이미 진행된 골다공증 환자에 유리하다. 현재 골 형성 기전의 골다공증 치료제로 허가 받은 제품으로는 Eli Lilly사의 Forteo가 있으며, PTH의 84개의 아미노산 중 N 말단의 34개의 아미노산으로 이루어진 펩타이드를 이용한다. 그러나, 반감기가 1시간 이하로 짧아서 1일 1회 피하주사로 투여하고 있으므로, 환자의 순응도가 낮다. 또한, 부작용으로 고칼슘혈증(hypercalcemia)를 일으킬 수 있으며, 2년 이상 장기적으로 사용하면 골육종(osteosarcoma)이 발생할 가능성이 높아서, 2년 이상의 사용을 금지하고 있다.
[5]
PTH의 안정성을 증가시키기 위해, PTH에 PEG(미국 특허 제6,506,730호) 또는 알부민(PCT 국제공개특허출원 WO2010/092135)을 결합시켜 혈중에서 long circulation을 유도하거나, 아미노산을 치환하는 방법(한국등록특허 제10-1183262호)으로 효소에 의한 분해를 감소시키는 방법으로 안정성을 증가시키려는 연구들이 있었다.
[6]
또한, 치과 또는 정형외과 영역에서 사용되는 의료기기의 골재생 및 골융합을 향상시키기 위해, 생리활성인자를 도입하려는 시도들이 있었다. 치과 또는 정형외과 영역에서 사용되는 의료기기로는 골이식재, 차폐막, 콜라겐이 함유된 복합재료, 금속 임플란트, 스크류 등이 있다. 그러나, 생리활성 인자가 표면에서 유리되어 분해되기 때문에, 그 효과가 크지 않았다.
[7]
[8]
이에, 본 발명자들은 상기와 같은 종래기술의 문제점을 해결하고자 예의 연구 노력한 결과, PTH 또는 그 절편에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드를 포함하는 약학 조성물 및 생체재료를 개발하였다. 상기 융합 펩타이드를 포함하는 약학 조성물이 골다공증, 골절과 같은 골재생 치료에 효과가 있음을 확인하고, 상기 융합 펩타이드를 치과 및 정형외과용 의료기기 표면에 결합시킨 후 이식하여 골재생 효과를 증가시킬 수 있음을 확인하고, 본 발명을 완성하였다.
[9]
[10]
본 배경기술 부분에 기재된 상기 정보는 오직 본 발명의 배경에 대한 이해를 향상시키기 위한 것이며, 이에 본 발명이 속하는 기술분야에서 통상의 지식을 가지는 자에게 있어 이미 알려진 선행기술을 형성하는 정보를 포함하지 않을 수 있다.
[11]
[12]
발명의 요약
[13]
본 발명의 목적은 안정성, 골조직에 대한 선택성 및 골재생 효과가 증가된 융합 펩타이드를 유효성분으로 포함하는 골 질환 예방 또는 치료용 약학 조성물을 제공하는 데 있다.
[14]
본 발명의 다른 목적은 안정성, 골조직에 대한 선택성 및 골재생 효과가 증가된 융합 펩타이드를 유효성분으로 포함하는 조성물을 투여하는 단계를 포함하는 골 질환의 예방 또는 치료방법을 제공하는 데 있다.
[15]
본 발명의 또 다른 목적은 안정성, 골조직에 대한 선택성 및 골재생 효과가 증가된 융합 펩타이드를 유효성분으로 포함하는 조성물을 골 질환의 예방 또는 치료에 사용하는 용도를 제공하는 데 있다.
[16]
본 발명의 또 다른 목적은 안정성, 골조직에 대한 선택성 및 골재생 효과가 증가된 융합 펩타이드를 결합된 생체재료를 제공하는 데 있다.
[17]
[18]
상기 목적을 달성하기 위하여, 본 발명은 부갑상선호르몬(parathyroid hormone, PTH) 또는 그 절편에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드를 유효성분으로 포함하는 골 질환 예방 또는 치료용 약학 조성물을 제공한다.
[19]
본 발명은 또한, 부갑상선호르몬 또는 그 절편에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드를 유효성분으로 포함하는 조성물을 투여하는 단계를 포함하는 골 질환의 예방 또는 치료방법을 제공한다.
[20]
본 발명은 또한, 부갑상선호르몬 또는 그 절편에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드를 유효성분으로 포함하는 조성물을 골 질환의 예방 또는 치료에 사용하는 용도를 제공한다.
[21]
본 발명은 또한, 부갑상선호르몬 또는 그 절편에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드가 결합된 생체재료를 제공한다.
[22]

도면의 간단한 설명

[23]
도 1은 (A)는 피하주사한 경우, (B)는 정맥주사한 경우, PTH 및 PTH에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드의 시간에 따른 혈액 내 농도를 나타낸 그래프이다(■는 PTH, ●는 PTH에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드).
[24]
도 2는 (A)는 골다공증 유발 마우스에 PTH 및 PTH에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드 주입 후 대퇴골의 마이크로씨티(microCT) 이미지이고, (B)는 Bone mineral density (BMD) 측정 결과이다(■는 No treatment, ●는 PTH, ▲는 PTH에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드).
[25]
도 3은 골다공증 유발 마우스에 PTH 및 PTH에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드 주입 후 혈액 내 칼슘 농도 측정 결과이다(■는 No treatment, ●는 PTH, ▲는 PTH에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드)
[26]
도 4는 토끼의 두개골에 PTH 및 PTH에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드가 결합된 골이식재를 이식한 후, 신생골의 조직학적 관찰결과와 조직계측학적 결과이다.
[27]
도 5는 형광으로 표지한 PTH 및 PTH에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드의 임플란트 주위 골조직에의 분포 결과이다.
[28]
[29]
발명의 상세한 설명 및 바람직한 구현예
[30]
다른 식으로 정의되지 않는 한, 본 명세서에서 사용된 모든 기술적 및 과학적 용어들은 본 발명이 속하는 기술분야에서 숙련된 전문가에 의해서 통상적으로 이해되는 것과 동일한 의미를 갖는다. 일반적으로 본 명세서에서 사용된 명명법은 본 기술분야에서 잘 알려져 있고 통상적으로 사용되는 것이다.
[31]
[32]
본 발명의 일 실시예에서, 부갑상선호르몬 또는 그 절편에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드를 포함하는 약학 조성물을 골다공증 유발 마우스에 주입하여, 부갑상선호르몬 보다 골밀도가 증가하고, 골재생 효과가 증가된 것을 확인하였다.
[33]
따라서, 본 발명은 일 관점에서, 부갑상선호르몬(parathyroid hormone, PTH) 또는 그 절편에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드를 유효성분으로 포함하는 골 질환 예방 또는 치료용 약학 조성물에 관한 것이다.
[34]
본 발명은 다른 관점에서, 부갑상선호르몬 또는 그 절편에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드를 유효성분으로 포함하는 조성물을 투여하는 단계를 포함하는 골 질환의 예방 또는 치료방법에 관한 것이다.
[35]
본 발명은 또 다른 관점에서, 부갑상선호르몬 또는 그 절편에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드를 유효성분으로 포함하는 조성물을 골 질환의 예방 또는 치료에 사용하는 용도에 관한 것이다.
[36]
[37]
본 발명에 있어서, 상기 융합 펩타이드는 골조직 형성을 유도하는 것을 특징으로 할 수 있다.
[38]
[39]
본 발명에 있어서, 상기 PTH는 서열번호 4의 아미노산 서열로 표시되는 것을 특징으로 할 수 있다.
[40]
본 발명에 있어서, 상기 절편은 서열번호 5의 아미노산 서열로 표시되는 것을 특징으로 할 수 있다.
[41]
서열번호 4: SVSEIQLMH NLGKHLNSME RVEWLRKKLQ DVHNFVALGA PLAPRDAGSQ RPRKKEDNVL VESHEKSLGE ADKADVNVLT KAKSQ
[42]
서열번호 5: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
[43]
[44]
본 발명에 있어서, 상기 PTH 또는 그 절편은 E.coli나 효모에서 발현된 재조합 PTH, PTH 관련 펩타이드(PTHrp) 또는 펩타이드 합성(peptide synthesis) 방법으로 제조된 것을 사용할 수 있다(Hefti et al., Clinical Science, 62, 389-396(1982); Liu et al., J. Bone Miner. Res., 6: 10, 1071-1080(1991); Hock et al., J. Bone. Min. Res., 7: 1. 65-71(1992)).
[45]
[46]
본 발명에 있어서, 상기 골조직 선택성 펩타이드는 서열번호 3의 아미노산 서열로 표시되는 것을 특징으로 할 수 있다.
[47]
본 발명에 있어서, 상기 골조직 선택성 펩타이드는 bone sialoprotein I 유래인 것을 특징으로 할 수 있으나, 이에 제한되는 것은 아니다.
[48]
본 발명에 있어서, 상기 PTH에 골조직 선택성을 부여하는 펩타이드는 골의 주요구성 성분인 콜라겐과 결합력을 가진 펩타이드이다. 골조직은 콜라겐 섬유에 미네랄성분이 침착된 구조를 이루고 있다. 따라서, 골조직 선택성 펩타이드에 의해 PTH의 골조직 내로의 이동을 증가시켜 준다.
[49]
본 발명의 일 실시예에서, 사용한 골조직 선택성을 부여하는 펩타이드는 세포 외 기질을 구성하는 단백질에서 활성부위의 아미노산 배열을 분리 추출한 것으로, 추출 후에 화학적 수식을 거쳐 활성구조를 유지하도록 하였다. 구체적으로, 상기 펩타이드는 사람의 bone sialoprotein I 149-169 위치의 아미노산 서열 YGLRSKS (서열번호 1), KKFRRPDIQYPDAT (서열번호 2), YGLRSKSKKFRRPDIQYPDAT (서열번호 3) 중 어느 하나의 아미노산 서열을 필수적으로 함유하도록 하였다. 화학적으로 PTH에 결합이 용이하도록 하기 위하여 상기 아미노산 서열 중 선택된 아미노산서열의 N-말단부위에 시스테인을 CGG- 또는 CGGGGG- 스페이서 형태로 부가하고 화학적으로 합성시켜 펩타이드를 제조하였다.
[50]
[51]
본 발명에 있어서, 상기 융합 펩타이드는 PTH 또는 그 절편의 C 말단에 골조직 선택성 펩타이드의 N 말단이 결합되어 있는 것을 특징으로 할 수 있다.
[52]
상기 PTH 또는 그 절편의 C 말단에 골조직 선택성 펩타이드를 고체상 펩타이드 합성법(solid phase peptide synthesis) 또는 화학 가교제를 사용하여 연결할 수 있으나, 이에 제한되는 것은 아니다.
[53]
본 발명에 있어서, 상기 PTH 또는 그 절편의 C 말단과 골조직 선택성 펩타이드의 N 말단을 연결하기 위해, 화학 가교제를 사용할 수 있다. 이때, 펩타이드 말단의 시스테인과 결합할 수 있는 관능기, 예를 들면 SH기를 도입하거나 아민(Amine, NH2)이 형성되도록 처리하여 향후 가교제에 의한 가교반응에 원활히 적용되도록 할 수 있다.
[54]
상기 화학적 가교제는 1,4-bis-maleimidobutane(BMB), 1,11-bis-maleimidotetraethyleneglycol(BM[PEO]4), 1-ethyl-3-[3-dimethyl aminopropyl] carbodiimide hydrochloride(EDC), succinimidyl-4-[N-maleimidomethylcyclohexane- 1-carboxy-[6-amidocaproate]](SMCC) 및 그의 설폰화염(sulfo-SMCC), succimidyl 6-[3-(2-pyridyldithio)-ropionamido] hexanoate](SPDP) 및 그의 설폰화염(sulfo-SPDP), m-maleimidobenzoyl-N- hydroxysuccinimide ester(MBS) 및 그의 설폰화염(sulfo-MBS), succimidyl [4-(p-maleimidophenyl) butyrate](SMPB) 및 그의 설폰화염(sulfo-SMPB) 등을 사용할 수 있으나, 이에 제한되는 것은 아니다.
[55]
PTH와 골조직 선택성 펩타이드의 결합반응 후에 가교제를 제거하기 위해, ultrafiltration과 같은 정제과정을 거치고, PTH에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드는 순도 90% 이상, 더 바람직하게는 순도 98% 이상을 얻어야 한다.
[56]
[57]
본 발명에 있어서, 상기 골 질환은 골다공증, 골형성 부전증, 고칼슘혈증, 골연화증, 파제트병(Paget's disease), 암에 의한 골 소실 및 골 괴사증, 골관절염, 류마티스 관절염, 치주질환 및 골절로 구성된 군에서 선택되는 어느 하나인 것을 특징으로 할 수 있으나, 이에 제한되는 것은 아니다.
[58]
[59]
본 발명에 있어서, 상기 골 질환 예방 또는 치료용 약학 조성물은 정맥내, 복강내, 근육내, 동맥내, 구강, 치주낭, 심장내, 골수내, 경막내, 경피, 장관, 피하, 설하 또는 국소 투여용으로 제형화되는 것을 특징으로 할 수 있으나, 이에 제한되는 것은 아니다.
[60]
본 발명에 있어서, 상기 골 질환 예방 또는 치료용 약학 조성물은 주사제, 구강점막 투여제, 캡슐제, 필름, 패취, 경피제 및 젤타입제로 구성된 군에서 선택되는 어느 하나로 제형화되는 것을 특징으로 하는 할 수 있으나, 이에 제한되는 것은 아니다. 상기 약학 조성물은 국소, 피하주사, 정백주사 또는 비경구 경로를 통해 투여될 수 있으며, 일반적으로 활성 성분으로서 본 발명에 따른 PTH 또는 그 절편에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드를 치료 유효량으로 함유하는 것을 특징으로 할 수 있다.
[61]
본 발명에 있어서, 상기 약학 조성물은 약학적으로 허용되는 불활성 무기 또는 유기 부형제를 사용하는 공지의 방법으로 제조할 수 있다. 주사액의 제조에 부형제로는 물, 알콜, 글리세롤, 폴리올, 식물성 오일 등이 있으나, 이에 제한되는 것은 아니다. 주사제는 또는 보존제, 무통화제, 가용화제 및 안정제를 혼합하여 사용할 수 있다. 국소 투여용 제제의 경우에는 젤형태나 필름형태로 제조할 수 있으며, 젤 기제로는 콜라겐, 키토산, 히알루론산, 알긴산, 프로필렌글리콜, 프로필렌글리콜 알긴산, 폴록사머, 황산 콘드로이틴 등을 사용하는 것이 바람직하다.
[62]
[63]
본 발명에 있어서, 상기 약학 조성물은 상기 융합 펩타이드의 함량이 10 내지 100μg인 것을 특징으로 할 수 있다. PTH 또는 그 절편에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드를 10 내지 100μg의 용량으로 1회에 사용되는 피하주사 또는 정맥주사로 사용할 수 있다.
[64]
[65]
본 발명의 일 실시예에서, PTH 또는 그 절편에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드가 결합된 골이식재를 이용하여 골재생 효과를 확인하였다.
[66]
따라서, 본 발명은 또 다른 관점에서, 부갑상선호르몬(parathyroid hormone, PTH)또는 그 절편에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드가 결합된 생체재료에 관한 것이다.
[67]
본 발명에 있어서, 상기 융합 펩타이드는 골조직 형성을 유도하는 것을 특징으로 할 수 있다.
[68]
본 발명에 있어서, 상기 PTH는 서열번호 4의 아미노산 서열로 표시되는 것을 특징으로 할 수 있다.
[69]
본 발명에 있어서, 상기 절편은 서열번호 5의 아미노산 서열로 표시되는 것을 특징으로 할 수 있다.
[70]
본 발명에 있어서, 상기 골조직 선택성 펩타이드는 서열번호 3의 아미노산 서열로 표시되는 것을 특징으로 할 수 있다.
[71]
본 발명에 있어서, 상기 융합 펩타이드는 PTH 또는 그 절편의 C 말단에 골조직 선택성 펩타이드의 N 말단이 결합되어 있는 것을 특징으로 할 수 있다.
[72]
본 발명에 있어서, 상기 PTH 또는 그 절편과 골조직 선택성 펩타이드는 가교제에 의해 결합되는 것을 특징으로 할 수 있다. 상기 가교제는 1,4-bis-maleimidobutane(BMB), 1,11-bis-maleimidotetraethyleneglycol(BM[PEO]4), 1-ethyl-3-[3-dimethyl aminopropyl] carbodiimide hydrochloride(EDC), succinimidyl-4-[N-maleimidomethylcyclohexane-1-carboxy-[6-amidocaproate]](SMCC) 및 그의 설폰화염(sulfo-SMCC), succimidyl 6-[3-(2-pyridyldithio)- propionamido]hexanoate](SPDP) 및 그의 설폰화염(sulfo-SPDP), m-maleimidobenzoyl-N-hydroxysuccinimide ester(MBS) 및 그의 설폰화염(sulfo-MBS), succimidyl [4-(p-maleimidophenyl) butyrate](SMPB) 및 그의 설폰화염(sulfo-SMPB)으로 구성된 군에서 선택되는 것을 특징으로 할 수 있으나, 이에 제한되는 것은 아니다.
[73]
[74]
본 발명에 있어서, 상기 생체재료는 골이식재, 차폐막, 임플란트 및 고분자 지지체로 구성된 군에서 선택되는 어느 하나인 것을 특징으로 할 수 있다. 당해 분야에서 사용하는 모든 종류 및 형태의 골이식재, 차폐막, 임플란트, 고분자 지지체를 사용할 수 있다.
[75]
상기 골이식재는 바람직하게는 자가골, 소뼈 및 돼지뼈에서 기인한 생물유래 골미네랄 분말 및 그 다공성 블록, 합성 수산화아파타이트 분말 및 그 다공성 블록, 트리칼슘인산 분말 및 그 다공성 블록 또는 수산화아파타이트와 트리칼슘인산의 혼합분말 및 그 다공성 블록을 주성분으로 포함하는 것을 특징으로 할 수 있다.
[76]
상기 차폐막은 바람직하게는 콜라겐, 키토산, 젤라틴, 폴리락타이드, 폴리락타이드글라콜라이드, 폴리카프로락톤으로 제조할 수 있으나, 이에 제한되는 것은 아니다.
[77]
상기 임플란트는 티타늄 합금(Titanium alloy), 산화티타늄(Titanium oxide) 또는 지르코니아(Zirconia)로 제조되는 것을 특징으로 할 수 있으나, 이에 제한되는 것은 아니다. 치과용 임플란트 및 정형외과용 임플란트를 포함하며, 정형외과용 임플란트는 골절합용판(orthopaedic fixation plate), 골절합용나사(orthopaedic bone screw), 골수내고정막대(orthopaedic bone nail) 등을 포함한다.
[78]
[79]
본 발명에 있어서, 상기 융합 펩타이드의 용량은 생체재료의 단위무게당(1g) 1 내지 10mg이 함유되는 것을 특징으로 할 수 있다. 더욱 바람직하게는, 생체재료의 단위무게당 2 내지 8mg이 함유되는 것을 특징으로 할 수 있다.
[80]
[81]
이하, 실시예를 통하여 본 발명을 더욱 상세히 설명하고자 한다. 이들 실시예는 오로지 본 발명을 예시하기 위한 것으로, 본 발명의 범위가 이들 실시예에 의해 제한되는 것으로 해석되지 않는 것은 당업계에서 통상의 지식을 가진 자에게 있어서 자명할 것이다.
[82]
[83]
제조예 1: Solid phase peptide synthesis에 의한 PTH에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드의 제조
[84]
N 말단으로부터 순서대로 골조직 선택성 펩타이드(서열번호 3)와 PTH 절편(서열번호 5)을 연결하여 F-moc 고체상 화학합성방법으로 펩타이드를 합성하였다. 합성된 펩타이드 서열은 레진으로부터 절단시켜 세척과정을 거쳐 동결건조 후 액체크로마토그래피에 의해 분리 정제되었다. 정제된 펩타이드는 MALDI-TOF 분석을 이용하여 분자량을 확인하였다.
[85]
[86]
대조예 1: PTH 절편의 제조
[87]
PTH 절편(서열번호 5)을 연결하여 F-moc 고체상 화학합성방법으로 펩타이드를 합성하였다. 합성된 펩타이드 서열은 레진으로부터 절단시켜 세척과정을 거쳐 동결건조 후 액체크로마토그래피에 의해 분리 정제되었다. 정제된 펩타이드는 MALDI-TOF 분석을 이용하여 분자량을 확인하였다.
[88]
[89]
제조예 2: 가교반응에 의한 PTH에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드의 제조
[90]
PTH 절편(서열번호 5) 1mg을 컨쥬게이션 반응 버퍼(100mM sodium phosphate, 150mM sodium chloride, 0.02% sodium azide, 1mM EDTA) 1ml에 용해하였다. Sulfo-SMCC(Thermo Scientific, 4.8mg/ml)용액 40μl를 PTH에 소량씩 가하고, 상온에서 1시간 또는 2시간동안 차광하여 반응하였다. 분자량 cut off (500)의 멤브레인으로 Ultrafiltration을 실시하여, 미반응된 sulfo-SMCC를 제거하였다. 여기에 서열번호 3의 펩타이드를 1mg/ml로 컨쥬게이션 버퍼에 녹인 용액을 가하여 4에서 8시간 차광하여 반응시켰다. PTH에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드를 분자량 cut off (3000)의 멤브레인으로 Ultrafiltration을 실시하여, 미반응된 서열번호 3의 펩타이드를 제거하였다. MALDI-TOF 와 SDS-PAGE를 이용하여, PTH에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드의 분자량을 확인하였다. PTH 절편의 분자량 4117.8과 골조직 선택성 펩타이드의 분자량 2365, Sulfo-SMCC에 의해 증가되는 분자량 219.09을 고려할 때, 이론적인 분자량은 6701.89 이상으로 나와야 한다.
[91]
[92]
제조예 3: PTH에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드를 포함하는 약학 조성물 제조
[93]
제조예 2의 PTH에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드를 유효성분으로 포함하는 약학 조성물을 제조하였다(표 1).
[94]
[95]
[표1] 제조예 3의 약학 조성물
성분 무게(mg)
PTH에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드 1
sodium chloride, USP 8.18
Sodium succinate 1.62
WFI 987.5
sodium hydroxide, NF and/or acetic acid, NF
합계 1g, pH 6

[96]
[97]
대조예 2: PTH를 포함하는 약학 조성물 제조
[98]
대조예 1의 PTH를 유효성분으로 포함하는 약학 조성물을 제조하였다(표 2).
[99]
[100]
[표2] 대조예 2의 약학 조성물
성분 무게(mg)
PTH 1
sodium chloride, USP 8.18
Sodium succinate 1.62
WFI 987.5
sodium hydroxide, NF and/or acetic acid, NF
합계 1g, pH 6

[101]
[102]
제조예 4: PTH에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드를 결합시킨 골이식재의 제조
[103]
소뼈 유래 골이식재 1g을 헥산에 용해한 3-아미노프로필 트리에톡시 실란(3-aminopropyl ethoxysilane, APTES, 1%)에 방치한 다음, 헥산에 3회 세척하였다. 이에 의해 표면에 아민 잔기가 형성되고, 여기에 가교제 BMB를 첨가하여 결합시켰다. 가교제가 결합된 골이식재 입자 1g에 제조예 2의 PTH에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드 20mg와 12시간 반응시킨 다음, 메탄올로 3회 세척하고, 정제수로 10회 세척하여 PTH에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드가 고정된 골이식재를 얻었다.
[104]
[105]
대조예 3: PTH를 결합시킨 골이식재의 제조
[106]
소뼈 유래 골이식재 1g을 헥산에 용해한 3-아미노프로필 트리에톡시 실란(3-aminopropyl ethoxysilane, APTES, 1%)에 방치한 다음, 헥산에 3회 세척하였다. 이에 의해 표면에 아민 잔기가 형성되고, 여기에 가교제 BMB를 첨가하여 결합시켰다. 가교제가 결합된 골이식재 입자 1g에 대조예 1의 PTH 20mg와 12시간 반응시킨 다음, 메탄올로 3회 세척하고, 정제수로 10회 세척하여 PTH가 고정된 골이식재를 얻었다.
[107]
[108]
제조예 5: PTH에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드의 젤타입 조성물 제조
[109]
제조예 2의 PTH에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드 20mg과 2% 콜라겐 용액 1ml를 균일하게 혼합하고, 주사기에 충진하였다.
[110]
[111]
대조예 4: PTH의 젤타입 조성물 제조
[112]
대조예 1의 PTH 20mg과 1-3% 콜라겐 용액 1ml를 균일하게 혼합하고, 주사기에 충진하였다.
[113]
[114]
실시예 1: PTH에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드의 반감기 확인 시험
[115]
대조예 2의 PTH를 포함하는 조성물과 제조예 3의 PTH에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드를 포함하는 조성물을 SD(Spraugue-Dawley) 웅성 랫트(체중 300-350 g)에 100μg/kg의 농도로 피하에 투여하고, 0, 2, 5, 10, 20, 30, 60, 180, 360, 720, 1440분에 혈액을 채취하였다. 또한, 100μg/kg의 농도로 경정맥에 투여하고, 0, 5, 10, 15, 30, 60, 90, 120, 180 및 360분에 혈액을 채취하고, 14,000rpm에서 10분간 원심분리하여 혈장을 분리하였다. PTH의 농도는 효소면역분석 방법(enzyme-linked immunosorbent assay (ELISA) technique (Immutopics, Inc., San Clemente, CA)을 사용하여 측정하였다.
[116]
도 1은 PTH에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드의 시간에 따른 혈액 내 농도를 나타낸 결과이다. 피하주사한 경우, PTH는 360분 이후에는 측정되지 않았으나, PTH에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드는 1440분까지 측정되었다. 정맥주사한 경우, PTH는 180분 이후에는 측정되지 않았으나, PTH에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드는 360분까지 측정되었다. 이는 PTH보다 PTH에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드의 반감기가 증가한 것을 의미한다.
[117]
[118]
실시예 2: PTH에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드의 골다공증 동물에서 효능 시험
[119]
6주된 ICR 마우스의 대퇴부에 실라진(Rompun®, Bayer사, 한국) 10mg/kg, 케타민(Ketalar®, 유한양행, 한국) 100mg/kg을 혼합하여 근육 주사로 전신마취한 후, 양측 신장의 하방에 존재하는 난소를 조심스럽게 전제거하였다. 통상 방법에 따라 봉합하고 겐타마이신(겐타마이신®, 중외제약, 한국) 3mg/kg을 근육주사하였다.
[120]
난소절제 3개월 후, 골소실여부를 확인하고, 대조예 2의 PTH를 포함하는 약학 조성물은 20μg/kg으로 매일, 3개월간 투여하였으며, 제조예 3의 PTH에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드를 포함하는 약학 조성물은 80μg/kg으로 주 1회, 6개월간 투여하였다. 골다공증은 유발하였으나 치료하지 않는 군과 비교하여 이후에 일어나는 골밀도의 변화를 평가하였다.
[121]
도 2는 골다공증 유발 마우스에 PTH에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드를 주입한 후, 대퇴골의 마이크로씨티(microCT) 이미지와 Bone mineral density (BMD) 측정 결과이다. 난소절제 후 치료를 하지 않은 군(no treatment)에서는 유의적인 골소실로 인한 골밀도가 감소되었다. PTH를 처리한 군보다는 PTH에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드를 처리한 군에서는 골밀도가 증가한 것으로 보였다(도 2(A)). 전체 대퇴골두 내의 미네랄함유량인 BMD(Bone Mineral Density)의 변화량을 측정한 결과(도 2(B)), 난소절제 후 치료를 하지 않은 군(no treatment)에서 BMD의 변화량은 감소함을 알 수 있었다. PTH 처리군은 1개월까지 BMD변화량이 증가하다가 2개월부터 감소하였다. PTH에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드는 6개월까지 BMD값이 증가함을 할 수 있었다. PTH보다는 PTH에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드가 골재생에 더 효과가 있는 것을 의미한다.
[122]
도 3은 골다공증 유발 마우스에 PTH에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드를 주입한 후, 혈액 내 칼슘의 농도 변화를 측정한 결과이다. 혈중 calcaium 농도는 QuantiChrom™ Calcium Assay Kit(Bioassay Systems, Hayward, CA)를 사용하여 측정하였다. PTH는 1개월에 칼슘의 농도를 증가시켰으나, PTH에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드는 혈중 칼슘의 농도를 증가시키지 않았다. PTH가 전신으로 영향을 주는 작용 중 하나가 뼈와 신장에 영향을 주어 혈중 칼슘 농도를 증가시키는 것이다. 따라서, PTH를 장기간 투여할 경우, 고칼슘혈증(hypercalcemia)을 유발하는 부작용을 일으킨다. 그러나, PTH에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드는 신장에는 영향이 없고, 골조직에만 영향을 주어 혈중 칼슘 농도를 증가시키는 작용을 하지 않는 것을 확인하였다.
[123]
[124]
실시예 3: PTH에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드의 골재생 시험
[125]
마취시킨 토끼(Newzealand White rabbit, 종명: cuniculus)의 두개골부위에 직경 10mm의 원형 골결손부를 형성시키고, 상기 골결손부에 제조예 4와 대조예 3에서 제조된 골이식재 100mg을 이식하고, 골막과 피부를 이중봉합 하였다. 이식 3주 후에 동물을 희생시키고, 채취한 표본은 포르말린 용액에 넣어 고정시킨 후, 조직을 포매하여 두께 20μm의 시편으로 제작하였다. 제작된 시편은 Hematoxylin-eosin으로 염색하여 비탈회 표본을 제작하였다. 제작된 표본은 광학현미경으로 관찰하여 사진 촬영을 실시하였다.
[126]
도 4는 토끼의 두개골에 PTH에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드가 결합된 골이식재를 이식한 후, 신생골의 조직학적 관찰결과와 조직계측학적 결과이다. PTH보다 PTH에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드의 골재생 효과가 증가하였다. 따라서, PTH에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드를 표면에 결합한 골이식재가 PTH를 결합한 골이식재 보다 골재생 효과가 클 것으로 기대된다.
[127]
[128]
실시예 4: PTH와 PTH에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드의 골이행 확인 시험
[129]
제조예 2의 PTH에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드에 cyanine5.5를 결합시키고, 미반응된 cyanine5.5를 제거하였다. Cyanine5.5가 표지된 PTH에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드를 제조예 5의 방법으로 제조하였다. 대조예 1의 PTH를 cyanine5.5와 결합시키고, 미반응된 cyanine5.5를 제거하였다. 대조군으로는 cyanine5.5가 표지된 PTH를 대조예 4의 방법으로 제조하였다.
[130]
비글독의 치아를 발치하고 8주 후, 임플란트를 이식하고, 수술부위에 cyanine5.5가 표지된 PTH에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드를 함유한 콜라겐 젤 100μL를 주입하고, 봉합하였다. 이식 3주 후에 동물을 희생시키고, 채취한 표본은 포르말린 용액에 넣어 고정시킨 후 조직을 포매하여 두께 20μm의 시편으로 제작하였다. 제작된 시편은 Hematoxylin-eosin으로 염색하여 비탈회 표본을 제작하였다. 제작된 표본은 Confocal microscopy로 관찰하여 사진 촬영을 실시하였고, 임플란트 주위의 일정한 면적당 형광 intensity를 측정하였다.
[131]
도 5는 형광으로 표지한 PTH에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드의 임플란트 주위 골조직에 분포를 보여준다. PTH를 이식하였을 때는 주변 골조직에 형광이 거의 관찰되지 않았으나, PTH에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드의 경우, 주변 골조직에 분포된 형광이 많이 관찰되었다. 이는 PTH와 비교할 때, PTH에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드가 골조직과 선택적으로 결합하는 것을 증명하는 것이다.
[132]

산업상 이용가능성

[133]
본 발명에 따르면, PTH 또는 그 절편에 골조직 선택성을 가진 펩타이드를 도입하여 골조직에 대한 선택성을 증가시키고, 골 재생 효과를 증가시킬 수 있다. 또한, PTH의 반감기를 증가시켜, 결과적으로 투여간격을 증가시킴으로써, 환자의 순응도를 증가시킬 수 있는 골 질환 예방 또는 치료용 약학 조성물로 개발할 수 있다. 또한, 치과 또는 정형외과 영역에서 사용되는 생체재료에 골조직 선택성 펩타이드가 결합되어 있는 PTH를 적용하여, 골재생 효과를 더 증가시키는데 유용하다.
[134]
[135]
이상으로 본 발명 내용의 특정한 부분을 상세히 기술하였는바, 당업계의 통상의 지식을 가진 자에게 있어서 이러한 구체적 기술은 단지 바람직한 실시 양태일 뿐이며, 이에 의해 본 발명의 범위가 제한되는 것이 아닌 점은 명백할 것이다. 따라서, 본 발명의 실질적인 범위는 첨부된 청구항들과 그것들의 등가물에 의하여 정의된다고 할 것이다.
[136]
[137]
전자파일 첨부하였음.

청구범위

[청구항 1]
부갑상선호르몬(parathyroid hormone, PTH) 또는 그 절편에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드를 유효성분으로 포함하는 골 질환 예방 또는 치료용 약학 조성물.
[청구항 2]
제1항에 있어서, 상기 융합 펩타이드는 골조직 형성을 유도하는 것을 특징으로 하는 골 질환 예방 또는 치료용 약학 조성물.
[청구항 3]
제1항에 있어서, 상기 부갑상선호르몬은 서열번호 4의 아미노산 서열로 표시되는 것을 특징으로 하는 골 질환 예방 또는 치료용 약학 조성물.
[청구항 4]
제1항에 있어서, 상기 절편은 서열번호 5의 아미노산 서열로 표시되는 것을 특징으로 하는 골 질환 예방 또는 치료용 약학 조성물.
[청구항 5]
제1항에 있어서, 상기 골조직 선택성 펩타이드는 서열번호 3의 아미노산 서열로 표시되는 것을 특징으로 하는 골 질환 예방 또는 치료용 약학 조성물.
[청구항 6]
제1항에 있어서, 상기 골조직 선택성 펩타이드는 bone sialoprotein I 유래인 것을 특징으로 하는 골 질환 예방 또는 치료용 약학 조성물.
[청구항 7]
제1항에 있어서, 상기 융합 펩타이드는 부갑상선호르몬 또는 그 절편의 C 말단에 골조직 선택성 펩타이드의 N 말단이 결합되어 있는 것을 특징으로 하는 골 질환 예방 또는 치료용 약학 조성물.
[청구항 8]
제1항에 있어서, 상기 골 질환은 골다공증, 골형성 부전증, 고칼슘혈증, 골연화증, 파제트병(Paget's disease), 암에 의한 골 소실 및 골 괴사증, 골관절염, 류마티스 관절염, 치주질환 및 골절로 구성된 군에서 선택되는 어느 하나인 것을 특징으로 하는 골 질환 예방 또는 치료용 약학 조성물.
[청구항 9]
제1항에 있어서, 정맥내, 복강내, 근육내, 동맥내, 구강, 치주낭, 심장내, 골수내, 경막내, 경피, 장관, 피하, 설하 또는 국소 투여용으로 제형화되는 것을 특징으로 하는 골 질환 예방 또는 치료용 약학 조성물.
[청구항 10]
제1항에 있어서, 주사제, 구강점막 투여제, 캡슐제, 필름, 패취, 경피제 및 젤타입제로 구성된 군에서 선택되는 어느 하나로 제형화되는 것을 특징으로 하는 골 질환 예방 또는 치료용 약학 조성물.
[청구항 11]
제1항에 있어서, 상기 융합 펩타이드의 함량이 10 내지 100μg인 것을 특징으로 하는 골 질환 예방 또는 치료용 약학 조성물.
[청구항 12]
부갑상선호르몬(parathyroid hormone, PTH) 또는 그 절편에 골조직 선택성 펩타이드가 결합되어 있는 융합 펩타이드가 결합된 생체재료.
[청구항 13]
제12항에 있어서, 상기 융합 펩타이드는 골조직 형성을 유도하는 것을 특징으로 하는 생체재료.
[청구항 14]
제12항에 있어서, 상기 부갑상선호르몬은 서열번호 4의 아미노산 서열로 표시되는 것을 특징으로 하는 생체재료.
[청구항 15]
제12항에 있어서, 상기 절편은 서열번호 5의 아미노산 서열로 표시되는 것을 특징으로 하는 생체재료.
[청구항 16]
제12항에 있어서, 상기 골조직 선택성 펩타이드는 서열번호 3의 아미노산 서열로 표시되는 것을 특징으로 하는 생체재료.
[청구항 17]
제12항에 있어서, 상기 융합 펩타이드는 부갑상선호르몬 또는 그 절편의 C 말단에 골조직 선택성 펩타이드의 N 말단이 결합되어 있는 것을 특징으로 하는 생체재료.
[청구항 18]
제12항에 있어서, 상기 생체재료는 골이식재, 차폐막, 임플란트 및 고분자 지지체로 구성된 군에서 선택되는 어느 하나인 것을 특징으로 하는 생체재료.
[청구항 19]
제18항에 있어서, 상기 골이식재는 생물유래 골미네랄 분말 및 그 다공성 블록, 합성 수산화아파타이트 분말 및 그 다공성 블록, 트리칼슘인산 분말 및 그 다공성 블록 또는 수산화아파타이트와 트리칼슘인산의 혼합분말 및 그 다공성 블록을 주성분으로 포함하는 것을 특징으로 하는 생체재료.
[청구항 20]
제18항에 있어서, 상기 차폐막은 콜라겐, 키토산, 젤라틴, 폴리락타이드, 폴리락타이드글라콜라이드 및 폴리카프로락톤으로 구성된 군에서 선택되는 어느 하나로 제조되는 것을 특징으로 하는 생체재료.
[청구항 21]
제18항에 있어서, 상기 임플란트는 티타늄 합금(Titanium alloy), 산화티타늄(Titanium oxide) 및 지르코니아(Zirconia)로 구성된 군에서 선택되는 어느 하나로 제조되는 것을 특징으로 하는 생체재료.
[청구항 22]
제12항에 있어서, 상기 융합 펩타이드의 용량은 생체재료의 단위무게당(1g) 1 내지 10mg이 함유되는 것을 특징으로 하는 생체재료.

도면

[도1]

[도2]

[도3]

[도4]

[도5]